top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|50732271|50756056|-|2|circRNA|GRB10|ENST00000401949.5|4,3 | circGRB10(4,3).B | GRB10 | LQRSKCNLKKAEGTHGFSRLPRFLFAPSVLPALALTTMLSRKQQLQAQ | AEGTHGFSRLPR | No | Alternative | Junction | 12 | 1 | CTG | TGA | NA | No |
chr7|51043382|51043692|-|1|circRNA|COBL|ENST00000431948.5|7 | circCOBL(7) | COBL | LAATAARMEPRRCCQRRRRPCQLAAVLRRRTRPRTQE | LAATAAR | No | Alternative | Alternative | 7 | 1 | CTG | TGA | TransCirc | No |
chr7|51043382|51043692|-|1|circRNA|COBL|ENST00000431948.5|7 | circCOBL(7) | COBL | LAATAARMEPRRCCQRRRRPCQLAAVLRRRTRPRTQE | LAATAARMEPR | No | Alternative | Alternative | 11 | 1 | CTG | TGA | TransCirc | No |
chr7|51190849|51193589|-|2|circRNA|COBL|ENST00000265136.11|4,3 | circCOBL(4,3) | COBL | LRFLSRIFSQSFVQSVRSAQSTWFSSGTTLPERSWSCPSP | IFSQSFVQSVRSAQSTWFSSGTTLPER | No | Alternative | Alternative | 27 | 2 | CTG | TGA | TransCirc | No |
chr7|5287808|5291821|+|4|circRNA|SLC29A4|NM_001300847|2,3,4,5 | circSLC29A4(2,3,4,5) | SLC29A4 | LRRVAAALLSGPGLRHQPGRCGHRGLRLHRGCHGLRGEPAP | VAAALLSGPGLRHQPGR | No | Alternative | Junction | 17 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page