top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr2|218497733|218562813|-|12|circRNA|USP37|ENST00000258399.7|13,12,11,10,9,8,7,6,5,4,3,2 | circUSP37(13,12,11,10,9,8,7,6,5,4,3,2) | USP37 | LHTCLLKKISVIQRPKRIYSRRLKMPFQLQQRDSLVICRI | MPFQLQQRDSLVICR | No | Alternative | Junction | 15 | 3 | TTG | TGA | TransCirc | No |
chr2|218509978|218558677|-|8|circRNA|USP37|ENST00000258399.7|11,10,9,8,7,6,5,4 | circUSP37(11,10,9,8,7,6,5,4) | USP37 | LGFLPQPVPLSVKKLRCNQDYTGWNKPRVPLSSHQQQQLQGQKQFLKKICLL | CNQDYTGWNKPRVPLSSHQQQQLQGQK | No | Junction | Junction | 27 | 2 | TTG | TGA | TransCirc | No |
chr2|218640663|218645064|-|2|circRNA|ZNF142|ENST00000449707.5|9,8 | circZNF142(9,8) | ZNF142 | MGTLLPRRMGVQSPALVMGIQFWFKSRRGLASPALHVPLAASRNGL | GLASPALHVPLAASR | No | Alternative | Alternative | 15 | 1 | ATG | TGA | TransCirc | No |
chr2|218660938|218662260|+|4|circRNA|BCS1L|ENST00000359273.7|2,3,4,5 | circBCS1L(2,3,4,5) | BCS1L | MGPLVAERAVLCFRNTPGPVRFGVSLSRCHFQTLFWL | FGVSLSR | No | Alternative | Junction | 7 | 1 | ATG | TGA | NA | No |
chr2|218737578|218740584|+|3|circRNA|TTLL4|NM_014640|3,4,5 | circTTLL4(3,4,5) | TTLL4 | LLAFEPVRKKPFFSPSKEPPCQSHCQQGHFFHGLLHGPAHGLLIHRTIPLLGSGWGKPFREEPGLCHLREDPISTLFLL | EEPGLCHLR | No | Alternative | Alternative | 9 | 3 | CTG | TAA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page