top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|105472131|105495253|-|5|circRNA|PUS7|ENST00000481939.5|10,9,8,7,6 | circPUS7(10,9,8,7,6) | PUS7 | LEIQENILGQNLGEVTATSYYIRKTKTPWMLLMYSPNT | LEIQENILGQNLGEVTATSYYIR | No | Junction | Junction | 23 | 3 | CTG | TAA | TransCirc | No |
chr7|105481051|105506056|-|6|circRNA|PUS7|ENST00000481939.5|9,8,7,6,5,4 | circPUS7(9,8,7,6,5,4) | PUS7 | LDLLTTMECKDLEPQLSLRIRLEGPFRRHIYSFDS | LEGPFRR | No | Alternative | Junction | 7 | 3 | TTG | TGA | TransCirc | No |
chr7|105505954|105508544|-|3|circRNA|PUS7|ENST00000481939.5|4,3,2 | circPUS7(4,3,2) | PUS7 | LTAEEKQRLEELQLFKNKETSVAIEVFLNVFLEP | ETSVAIEVFLNVFLEP | No | Junction | Junction | 16 | 1 | TTG | TAA | TransCirc | No |
chr7|107783356|107786826|-|1|ciRNA|SLC26A3|ENST00000379083.7|8 | ciSLC26A3(8) | SLC26A3 | LHPASLRKAHCFPSRKVLQRKAGCAVLFFFFSPPHSECSS | LHPASLR | No | Alternative | Alternative | 7 | 2 | CTG | TAA | NA | No |
chr7|107929063|107932377|-|4|circRNA|LAMB1|NM_002291|31,30,29,28 | circLAMB1(31,30,29,28) | LAMB1 | LNVAGQTAELTKERGSVGGLAVVVWLLLHTTPGRKPWTWTKMS | LNVAGQTAELTK | No | Alternative | Alternative | 12 | 3 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page