top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|42148225|42148468|-|1|circRNA|GLI3|ENST00000395925.7|3 | circGLI3(3) | GLI3 | MGPCHTWRSPLCRTAGRCLPWTPGMVTWSPTTRMKVLDRLITEREETQSLCSHRMSRGSAKSVRNLQHRVTRGPH | CLPWTPGMVTWSPTTRMK | No | Junction | Junction | 18 | 1 | ATG | TGA | TransCirc | No |
chr7|42148225|42223295|-|2|circRNA|GLI3|ENST00000395925.7|3,2 | circGLI3(3,2) | GLI3 | MGPCHTWRSPLCRTAGRCLPWTPGMVTWSPTTGIFGRRELK | CLPWTPGMVTWSPTTGIFGRR | No | Junction | Junction | 21 | 1 | ATG | TAA | TransCirc | No |
chr7|42148225|42223295|-|2|circRNA|GLI3|ENST00000395925.7|3,2 | circGLI3(3,2) | GLI3 | MGPCHTWRSPLCRTAGRCLPWTPGMVTWSPTTGIFGRRELK | TAGRCLPWTPGMVTWSPTTGIFGR | No | Junction | Junction | 24 | 1 | ATG | TAA | TransCirc | No |
chr7|44425899|44427703|-|2|circRNA|NUDCD3|ENST00000460110.5|3,2 | circNUDCD3(3,2) | NUDCD3 | LFPSATNTKFIFLQLQTPGHPPLNYIRSWVRPIEAPSSPERQSKEPRSQR | LFPSATNTK | No | Alternative | Alternative | 9 | 2 | TTG | TGA | NA | No |
chr7|44645326|44666851|+|3|circRNA|OGDH|NM_001003941|3,4,5 | circOGDH(3,4,5) | OGDH | MAWMSLTSTRSSTCPPPLSSGDRNQHFLCGRSSVGWSHGTFFFATRMPEPHRALPTRVPFP | MPEPHRALPTR | No | Alternative | Junction | 11 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page