top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|24830767|24834736|-|2|circRNA|OSBPL3|NM_145320|14,13 | circOSBPL3(14,13) | OSBPL3 | MWQPLPYQRMHLATTELEASHLIRFLEKHMNVFGRTRASSFFQNRACP | HMNVFGRTR | No | Alternative | Junction | 9 | 2 | ATG | TGA | NA | No |
chr7|24830767|24834736|-|2|circRNA|OSBPL3|NM_145320|14,13 | circOSBPL3(14,13) | OSBPL3 | MWQPLPYQRMHLATTELEASHLIRFLEKHMNVFGRTRASSFFQNRACP | TRASSFFQNR | No | Alternative | Junction | 10 | 2 | ATG | TGA | NA | No |
chr7|24830767|24872069|-|13|circRNA|OSBPL3|NM_145320|14,13,12,11,10,9,8,7,6,5,4,3,2 | circOSBPL3(14,13,12,11,10,9,8,7,6,5,4,3,2) | OSBPL3 | MWQPLPYQRMHLATTELEASHLIRFLEKHMNVFGRTRASSFFQNRTAGKWWKD | ASSFFQNRTAGK | No | Junction | Junction | 12 | 2 | ATG | TGA | TransCirc | No |
chr7|24830767|24872069|-|13|circRNA|OSBPL3|NM_145320|14,13,12,11,10,9,8,7,6,5,4,3,2 | circOSBPL3(14,13,12,11,10,9,8,7,6,5,4,3,2) | OSBPL3 | MYSGGQGLPVFFRTGQLGSGGRTEGGDELHPGATSSERIFAEKEEVALKRLA | GQLGSGGRTEGGDELHPGATSSER | No | Alternative | Junction | 24 | 3 | ATG | TAA | riboCIRC,TransCirc | No |
chr7|24830767|24872069|-|13|circRNA|OSBPL3|NM_145320|14,13,12,11,10,9,8,7,6,5,4,3,2 | circOSBPL3(14,13,12,11,10,9,8,7,6,5,4,3,2) | OSBPL3 | MYSGGQGLPVFFRTGQLGSGGRTEGGDELHPGATSSERIFAEKEEVALKRLA | IFAEKEEVALK | No | Alternative | Junction | 11 | 3 | ATG | TAA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page