top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr5|170252535|170253118|-|1|ciRNA|LCP2|ENST00000046794.9|18 | ciLCP2(18) | LCP2 | LIYGNDYSEAFLFTYICNCKIYSVREHVFIFVCLPFPW | EHVFIFVCLPFPW | No | Alternative | Junction | 13 | 2 | TTG | TAA | NA | No |
chr5|170892386|170968377|+|11|circRNA|RANBP17|ENST00000523189.5|4,5,6,7,8,9,10,11,12,13,14 | circRANBP17(4,5,6,7,8,9,10,11,12,13,14) | RANBP17 | LQFCGSWISFVKHMLVINFKEPQRKLHSELRGITAQAGSLCHPSSYSSHC | HMLVINFK | No | Alternative | Junction | 8 | 3 | TTG | TAA | TransCirc | No |
chr5|173080584|173123202|+|7|circRNA|CREBRF|ENST00000296953.6|2,3,4,5,6,7,8 | circCREBRF(2,3,4,5,6,7,8) | CREBRF | MREDPTWGRSLKSSLKILSTASHRIILKKSSDPSN | ILSTASHR | No | Alternative | Junction | 8 | 1 | ATG | TGA | NA | No |
chr5|176295262|176296247|+|1|ciRNA|SIMC1|NM_001308195|3 | ciSIMC1(3) | SIMC1 | LLKENLMARVTRNRGVRCDLIQYTKMVTRVHSAALLRFCLGLHVVASQPQFCFGAACGSLSASVLFWGRMW | VHSAALLR | No | Alternative | Alternative | 8 | 1 | CTG | TAG | NA | No |
chr5|176951473|176982623|-|8|circRNA|UIMC1|ENST00000377227.8|9,8,7,6,5,4,3,2 | circUIMC1(9,8,7,6,5,4,3,2) | UIMC1 | LDGVRIIMADKETKGCHGERKKLKKSPNLGTWRRRMWKLPVLSV | KSPNLGTWR | No | Alternative | Junction | 9 | 3 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page