top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|76256177|76263843|+|2|circRNA|FAM47E|NM_001136570|2,3 | circFAM47E(2,3) | FAM47E | LWRAFCPRFITELPNWPQRRGRSSCSRKQTCFPSSRQPSRLGRHSWRTWRPT | FITELPNWPQR | No | Alternative | Alternative | 11 | 2 | CTG | TGA | TransCirc | No |
chr4|76396268|76403280|-|2|circRNA|CCDC158|ENST00000504868.1|4,3 | circCCDC158(4,3) | CCDC158 | LTQVPFFPKYEVELDSPRKIIPSPGKEHFERVLEEYSHQVKDLQRRLNETGTKRTKEGTIHTSRSLIRSSNI | EGTIHTSR | No | Alternative | Junction | 8 | 3 | TTG | TAA | TransCirc | No |
chr4|76710155|76741926|+|3|circRNA|SHROOM3|NM_020859|3,4,5 | circSHROOM3(3,4,5) | SHROOM3 | LAATAFLGPRGAAEPRGVGLRLPAHAPGAAQRDPC | GAAEPRGVGLR | No | Alternative | Alternative | 11 | 1 | CTG | TGA | TransCirc | No |
chr4|76710155|76741926|+|3|circRNA|SHROOM3|NM_020859|3,4,5 | circSHROOM3(3,4,5) | SHROOM3 | LAATAFLGPRGAAEPRGVGLRLPAHAPGAAQRDPC | LAATAFLGPR | No | Alternative | Alternative | 10 | 1 | CTG | TGA | TransCirc | No |
chr4|76710155|76741926|+|3|circRNA|SHROOM3|NM_020859|3,4,5 | circSHROOM3(3,4,5) | SHROOM3 | LAATAFLGPRGAAEPRGVGLRLPAHAPGAAQRDPC | LAATAFLGPRGAAEPR | No | Alternative | Alternative | 16 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page