top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr8|133250439|133250543|1|104|0 | circNDRG1(1L) | NDRG1 | MQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNRKKCRVTWKWSTPTASTL | MQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNR | No | Alternative | Junction | 33 | 1 | ATG | TGA | TransCirc | Yes |
chr8|139936622|139937090|1|468|0 | circENST00000625034.1(NE) | ENST00000625034.1 | LSVVIKQGENGGAGTTVWYKAWGEWGVGTAVWYKAGRE | AWGEWGVGTAVWYK | No | Alternative | Alternative | 14 | 1 | CTG | TAG | NA | Yes |
chr8|141218763|141218977|1|214|0 | circSLC45A4(NE) | SLC45A4 | LVPDPEPGALLLCRHHLHGVRGPAPVQHRRGAVQPAAGAQR | GAVQPAAGAQR | No | Alternative | Alternative | 11 | 1 | CTG | TGA | TransCirc | No |
chr8|141218763|141218977|1|214|0 | circSLC45A4(NE) | SLC45A4 | LVPDPEPGALLLCRHHLHGVRGPAPVQHRRGAVQPAAGAQR | GPAPVQHRR | No | Alternative | Alternative | 9 | 1 | CTG | TGA | TransCirc | No |
chr8|143274697|143274936|1|239|0 | circENST00000522452(S1S) | ENST00000522452 | LGDQSSARARLLTMPTSVAPPMLAPPPSWGPFSSLASAPGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPGE | LGDQSSARAR | No | Alternative | Junction | 10 | 2 | CTG | TGA | NA | No |
Page 1 of 1
bottom of page