top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|129168246|129168561|1|315|0 | circTSPAN33(S1L) | TSPAN33 | LAVESSTGSPAWTPLGMIPAPEGKGVEQAVRREPGGRLGTAVCAR | GVEQAVR | No | Alternative | Alternative | 7 | 3 | CTG | TAG | NA | No |
chr7|129168246|129168561|1|315|0 | circTSPAN33(S1L) | TSPAN33 | LAVESSTGSPAWTPLGMIPAPEGKGVEQAVRREPGGRLGTAVCAR | LGTAVCAR | No | Alternative | Alternative | 8 | 3 | CTG | TAG | NA | No |
chr7|129168246|129168561|1|315|0 | circTSPAN33(S1L) | TSPAN33 | LGVGWGQPYVLGRSGGRYVYQMPVLPSSQVVRVSYILPRLHFHGNMAARTRGTTAAKFFPTSILRS | LGVGWGQPYVLGR | No | Alternative | Junction | 13 | 1 | CTG | TAA | NA | Yes |
chr7|129168246|129168561|1|315|0 | circTSPAN33(S1L) | TSPAN33 | LGVGWGQPYVLGRSGGRYVYQMPVLPSSQVVRVSYILPRLHFHGNMAARTRGTTAAKFFPTSILRS | VSYILPR | No | Alternative | Junction | 7 | 1 | CTG | TAA | NA | No |
chr7|129168246|129168561|1|315|0 | circTSPAN33(S1L) | TSPAN33 | LGVGWGQPYVLGRSGGRYVYQMPVLPSSQVVRVSYILPRLHFHGNMAARTRGTTAAKFFPTSILRS | YVYQMPVLPSSQVVR | No | Alternative | Junction | 15 | 1 | CTG | TAA | NA | Yes |
Page 1 of 1
bottom of page