top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr4|151159239|151165696|2|113,108|0,6349 | circSH3D19(L1S,2S) | SH3D19 | MRIHKVHLLSLLKNLLETLSVQYLESSVMLRELET | NLLETLSVQYLESSVMLR | Yes | Alternative | Alternative | 18 | 1 | ATG | TGA | NA | Yes |
chr4|154566488|154566672|1|184|0 | circFGB(2) | FGB | LCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKGGVVSYRMSVARGFATTGKANQK | GGVVSYR | Yes | Alternative | Junction | 7 | 1 | TTG | TAG | TransCirc | No |
chr4|185247293|185267155|2|61,163|0,19699 | circSNX25(NE,NE).C | SNX25 | MSNPDYINQMLLAQLAYREQMNEHHKRAYTYAPSYEDFIKLINSNSDVEFLKQLRVLCMETHMSQLSLEG | MSNPDYINQMLLAQLAYR | No | Alternative | Junction | 18 | 1 | ATG | TAG | TransCirc | Yes |
chr4|185247293|185267155|3|102,107,187|0,17210,19675 | circSNX25(NE,NE,NE) | SNX25 | MRISTNVFSGSGVLSPPLKGCAVSQLTYNACRNSHNKSLEAGSGVTE | ISTNVFSGSGVLSPPLK | No | Alternative | Junction | 17 | 1 | ATG | TAA | NA | Yes |
chr4|185247293|185267155|3|102,107,187|0,17210,19675 | circSNX25(NE,NE,NE) | SNX25 | MRISTNVFSGSGVLSPPLKGCAVSQLTYNACRNSHNKSLEAGSGVTE | ISTNVFSGSGVLSPPLKGCAVSQLTYNACR | No | Alternative | Junction | 30 | 1 | ATG | TAA | NA | Yes |
Page 1 of 1
bottom of page