top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|18415110|18420991|2|70,57|0,5824 | circSATB1(NE,S2S) | SATB1 | LSMDHLNEATQGKECSEGLTERYESEFIGQGVPPFTGDL | LSMDHLNEATQGKECSEGLTER | No | Alternative | Junction | 22 | 1 | CTG | TAG | riboCIRC,TransCirc | No |
chr3|186618535|186619940|2|102,84|0,1321 | circAHSG(NE,NE) | AHSG | MWSLQCLALTVLLKRPQRQPSVTCWQKSNMAFVRQHSVRSLVGQRLQ | QHSVRSLVGQR | No | Alternative | Junction | 11 | 2 | ATG | TGA | TransCirc | No |
chr3|186722436|186727344|3|85,42,27|0,2651,4881 | NA | KNG1 | MHGNRGEEEQYEILRGYPDLPDYSSRGPCGDSPVRLPRLQTASPFGMVPLENARQPWGRGAVRNSPWLPRPARLLQPRALW | NSPWLPRPAR | No | Alternative | Junction | 10 | 3 | ATG | TGA | TransCirc | No |
chr3|191491721|191492232|1|511|0 | circT257092(NE) | T257092 | LVFVILIYPKCLRLYLIKMEYFIFITRAVKNVRTELNMV | LYLIKMEYFIFITR | No | Alternative | Alternative | 14 | 1 | TTG | TAG | NA | Yes |
chr3|196356515|196356787|1|272|0 | circUBXN7(NE) | UBXN7 | LAHRTTEPKLGKQVTFLLLFLDLSYNQSLSPPTFLEGNYLIWTMILHCKRQAFVLKRLSLYRKEINTMA | LAHRTTEPK | No | Alternative | Junction | 9 | 2 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page