top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr21|34880579|34886912|2|134,70|0,6263 | NA | RUNX1 | LLRAAYALALQQDPAHRFQGGGPRGCSRWHSGHCDGWQ | FQGGGPR | No | Alternative | Junction | 7 | 1 | CTG | TGA | NA | No |
chr21|37420298|37472880|3|86,106,31|0,52385,52551 | circDYRK1A(1,2S,S2) | DYRK1A | MRLERRRCIQEERLQHANLHLFGLHRHFHSMLLAFRWLDRCPIHIMTRFSNL | HFHSMLLAFR | Yes | Alternative | Junction | 10 | 1 | ATG | TAA | riboCIRC,TransCirc | Yes |
chr21|37420298|37472880|3|86,110,72|0,1475,52510 | circDYRK1A(NE,1,S2) | DYRK1A | LKEDDAYRNYFSALSAPGLLLGRYTAHWLYQVDAHFRLRSVEEQTKHK | NYFSALSAPGLLLGR | Yes | Alternative | Junction | 15 | 1 | TTG | TGA | NA | Yes |
chr21|37420298|37472880|3|86,110,72|0,1475,52510 | circDYRK1A(NE,1,S2) | DYRK1A | LKEDDAYRNYFSALSAPGLLLGRYTAHWLYQVDAHFRLRSVEEQTKHK | YTAHWLYQVDAHFR | Yes | Alternative | Junction | 14 | 1 | TTG | TGA | NA | Yes |
chr21|37420298|37472880|3|86,110,72|0,1475,52510 | circDYRK1A(NE,1,S2) | DYRK1A | LKEDDAYRNYFSALSAPGLLLGRYTAHWLYQVDAHFRLRSVEEQTKHK | YTAHWLYQVDAHFRLR | Yes | Alternative | Junction | 16 | 1 | TTG | TGA | NA | Yes |
Page 1 of 1
bottom of page