top of page
Long-Read CircRNA Encoded Peptides
Use criteria below to search among 994 circRNA peptides detected by long-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Long-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|number of exons|exon sizes|exon offsets"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Short-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|82087984|82088222|2|50,107|0,131 | circFASN(NE,NE).D | FASN | LARALGLGVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEHSVEDAGPRPGPGRRAAACGV | RAAACGV | No | Alternative | Junction | 7 | 2 | CTG | TGA | NA | No |
chr17|82088968|82089384|2|204,135|0,281 | circFASN(NE,NE).F | FASN | LCCSRRPCGTCLSTRWCWRSRPTPCCRPRCLSSWSS | RPCGTCLSTR | No | Alternative | Junction | 10 | 2 | CTG | TGA | TransCirc | No |
chr17|82096318|82096447|1|129|0 | circFASN(L2) | FASN | LEGGHGGGGDCRHVREAARVGELAGVLGQPHRRCGHGHGR | LEGGHGGGGDCRHVR | No | Junction | Junction | 15 | 2 | CTG | TGA | TransCirc | No |
chr17|82096318|82096447|1|129|0 | circFASN(L2) | FASN | LPACPGSCQSRRTCRSSGTTSSAVWTWSRTMTVAGRRPWRRW | TMTVAGR | No | Alternative | Junction | 7 | 1 | TTG | TGA | TransCirc | No |
chr17|9709955|9712132|2|101,45|0,2132 | circUSP43(2S,S3) | USP43 | LDGQWYSYDDSTVEPLREDEVNTRGAYILTLPSSPTASAIRKRPTAGTLWMASGTVMMTARWNRFEKMRSTPEGLIS | RPTAGTLWMASGTVMMTARWNR | Yes | Junction | Junction | 22 | 3 | CTG | TGA | TransCirc | Yes |
Page 1 of 1
bottom of page