top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PART1:16 | OV | 11 | 0.0959524 | noncoding | 54 | chr5 | 60488177 | 60492853 | + | 0.9082 | PART1 | 0.041 | 0 | 0 | 0 | 12 | noncoding | -0.335908263 | VNSMEYYAAIK | n[145]VNSM[147]EYYAAIK | LKMKVNSMEYYAAIKKDEIMSFAGRWMKLETIILSKLSQGQKTKHRMFSLIGGN |
PART1:6 | LUAD | 7 | 0.0513729 | noncoding | 42 | chr5 | 60488139 | 60547657 | + | 0.9997 | PART1 | 0.814 | -5.407 | -5.113 | -4.965 | 24 | noncoding | -0.345744014 | ASQSITK | n[230]ASQSITK | MASQSITKLRILTVLCISSLHVMYMCVFVYINHFPFSLFIIL |
PARTICL:2 | PRAD | 10 | 0.160175 | noncoding | 75 | chr2 | 85536387 | 85538977 | - | 0.9981 | PARTICL | 1 | -2.098 | -4.323 | -4.539 | 1 | noncoding | -0.3348936 | TILSVGAGGK | LLAAVEQGAFPRTILSVGAGGKVGFAKGSVGNKGSTWAVLGASTKKIKGSSPDSVTTSTVAQSRQQEKVRPQKRQ | |
PAUPAR:10 | BRCA-Luminal B | 7 | 0.211025 | noncoding | 68 | chr11 | 31819146 | 31837055 | + | 0.9984 | PAUPAR | 0.226 | 0 | 0 | 0 | 4 | noncoding | -0.27025735 | MGALAEK | n[145]MGALAEK | LSCSARRGLEGRVGVGVGVGVEVGVAVKVGRRMGALAEKFPQDVLTYLQTFSKLSFFFLTPWASCVKA |
PAUPAR:10 | BRCA-Luminal A | 7 | 0.211025 | noncoding | 68 | chr11 | 31819146 | 31837055 | + | 0.9984 | PAUPAR | 0.226 | 0 | 0 | 0 | 4 | noncoding | -0.27025735 | MGALAEK | n[145]MGALAEK | LSCSARRGLEGRVGVGVGVGVEVGVAVKVGRRMGALAEKFPQDVLTYLQTFSKLSFFFLTPWASCVKA |
Page 1 of 1
bottom of page