top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PLCXD2-AS1:3 | BRCA-Luminal B | 7 | 0.0226268 | noncoding | 39 | chr3 | 111675942 | 111677428 | - | 0.999 | PLCXD2-AS1 | 1 | -5.509 | -4.78 | -4.78 | 27 | noncoding | -0.373182166 | SPLLAQK | n[145]SPLLAQK | MADKTYMIITIKKFRSPLLAQKQPGPMRTMNLEDTQKRR |
PLCXD2-AS1:3 | BRCA-Basal-like | 7 | 0.0226268 | noncoding | 39 | chr3 | 111675942 | 111677428 | - | 0.999 | PLCXD2-AS1 | 1 | -5.509 | -4.78 | -4.78 | 27 | noncoding | -0.373182166 | SPLLAQK | n[145]SPLLAQK | MADKTYMIITIKKFRSPLLAQKQPGPMRTMNLEDTQKRR |
PLCXD2-AS1:3 | BRCA-Luminal A | 7 | 0.0226268 | noncoding | 39 | chr3 | 111675942 | 111677428 | - | 0.999 | PLCXD2-AS1 | 1 | -5.509 | -4.78 | -4.78 | 27 | noncoding | -0.373182166 | SPLLAQK | n[145]SPLLAQK | MADKTYMIITIKKFRSPLLAQKQPGPMRTMNLEDTQKRR |
PLCXD2-AS1:3 | BRCA-HER2-enriched | 7 | 0.0226268 | noncoding | 39 | chr3 | 111675942 | 111677428 | - | 0.999 | PLCXD2-AS1 | 1 | -5.509 | -4.78 | -4.78 | 27 | noncoding | -0.373182166 | SPLLAQK | n[145]SPLLAQK | MADKTYMIITIKKFRSPLLAQKQPGPMRTMNLEDTQKRR |
PLCXD2-AS1:3 | CCRC | 7 | 0.0226268 | noncoding | 39 | chr3 | 111675942 | 111677428 | - | 0.9998 | PLCXD2-AS1 | 1 | -5.509 | -4.78 | -4.78 | 35 | noncoding | -0.373182166 | SPLLAQK | n[230]SPLLAQK | MADKTYMIITIKKFRSPLLAQKQPGPMRTMNLEDTQKRR |
Page 1 of 1
bottom of page