top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PRKCA-AS1:1 | OV | 10 | 0.116988 | noncoding | 69 | chr17 | 66398068 | 66416854 | - | 0.9025 | PRKCA-AS1 | 0.017 | -4.141 | -4.787 | -5.342 | 33 | noncoding | -0.303118866 | MFPAGGGSTR | n[145]M[147]FPAGGGSTR | MDRVDLRQTIHSEVSGTRGVQSTHRNRMFPAGGGSTRLHRLQSQAARDQIPAPPFSCDGACSTSLISLN |
PRKCQ-AS1:22 | OSCC | 17 | 0.013895 | noncoding | 38 | chr10 | 6583830 | 6615893 | + | 0.998 | PRKCQ-AS1 | 0.207 | 0 | 0 | 0 | 21 | noncoding | -0.400798461 | MCLLPSTMIVRPPQPHR | n[145]MCLLPSTMIVRPPQPHR | MCLLPSTMIVRPPQPHRTESILNFLCKLGKAVDNRWML |
PRKCQ-AS1:45 | BRCA-Luminal B | 18 | 0.0315202 | noncoding | 51 | chr10 | 6580505 | 6626686 | + | 0.9948 | PRKCQ-AS1 | 0.046 | -5.236 | -4.646 | -5.41 | 23 | noncoding | -0.333259629 | MNQVPHGAGSVVDTGNMK | n[145]M[147]NQVPHGAGSVVDTGNMK | MNQVPHGAGSVVDTGNMKESTDRDPLPSRSPHSSRKRQAINKAKKYVIHCV |
PRKCQ-AS1:45 | BRCA-Luminal A | 18 | 0.0315202 | noncoding | 51 | chr10 | 6580505 | 6626686 | + | 0.9948 | PRKCQ-AS1 | 0.046 | -5.236 | -4.646 | -5.41 | 23 | noncoding | -0.333259629 | MNQVPHGAGSVVDTGNMK | n[145]M[147]NQVPHGAGSVVDTGNMK | MNQVPHGAGSVVDTGNMKESTDRDPLPSRSPHSSRKRQAINKAKKYVIHCV |
PRKCQ-AS1:45 | BRCA-Basal-like | 18 | 0.0315202 | noncoding | 51 | chr10 | 6580505 | 6626686 | + | 0.9948 | PRKCQ-AS1 | 0.046 | -5.236 | -4.646 | -5.41 | 23 | noncoding | -0.333259629 | MNQVPHGAGSVVDTGNMK | n[145]M[147]NQVPHGAGSVVDTGNMK | MNQVPHGAGSVVDTGNMKESTDRDPLPSRSPHSSRKRQAINKAKKYVIHCV |
Page 1 of 1
bottom of page