top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PXN-AS1:4 | OV | 10 | 0.011217 | noncoding | 33 | chr12 | 120201326 | 120210519 | + | 0.1517 | PXN-AS1 | 0.971 | 0 | 0 | 0 | 1 | noncoding | -0.323334221 | LDTFTIRGPR | n[145]LDTFTIRGPR | LDTFTIRGPRTGALDLTGAKRKHANPDMTTRRQ |
PXN-AS1:4 | OV | 20 | 0.011217 | noncoding | 33 | chr12 | 120201326 | 120210519 | + | 0.9893 | PXN-AS1 | 0.971 | 0 | 0 | 0 | 3 | noncoding | -0.323334221 | LDTFTIRGPRTGALDLTGAK | n[145]LDTFTIRGPRTGALDLTGAK | LDTFTIRGPRTGALDLTGAKRKHANPDMTTRRQ |
RAB11B-AS1:6 | CCRC | 9 | 0.366783 | noncoding | 40 | chr19 | 8361554 | 8390663 | - | 0.9941 | RAB11B-AS1 | 1 | 12.101 | -5.566 | -4.664 | 15 | noncoding | -0.273023675 | TFISSQDAK | n[230]TFISSQDAK | LRVRSACSRSPWPSCRSPCARTFISSQDAKRGDLDCTGPP |
RAB11B-AS1:6 | CCRC | 9 | 0.366783 | noncoding | 40 | chr19 | 8361554 | 8390663 | - | 0.9941 | RAB11B-AS1 | 1 | 12.101 | -5.566 | -4.664 | 15 | noncoding | -0.273023675 | TFISSQDAK | TFISSQDAK | LRVRSACSRSPWPSCRSPCARTFISSQDAKRGDLDCTGPP |
PLCXD2-AS1:3 | HCC | 7 | 0.0226268 | noncoding | 39 | chr3 | 111675942 | 111677428 | - | 0.9982 | PLCXD2-AS1 | 1 | -5.509 | -4.78 | -4.78 | 28 | noncoding | -0.373182166 | SPLLAQK | SPLLAQK | MADKTYMIITIKKFRSPLLAQKQPGPMRTMNLEDTQKRR |
Page 1 of 1
bottom of page