top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
RALY-AS1:17 | EOGC | 10 | 0.81785 | coding | 62 | chr20 | 33980742 | 33993133 | - | 0.9827 | RALY-AS1 | 0.894 | -4.962 | -3.126 | -4.451 | 14 | noncoding | -0.334731327 | LEGCDSGVAR | n[145]LEGCDSGVAR | LVRAMSVSFKLGQLEISPGTFYTKTNGEMFSELQELLKLEGCDSGVARVHLPLPVEKSACDW |
RALY-AS1:17 | EOGC | 9 | 0.81785 | coding | 62 | chr20 | 33980742 | 33993133 | - | 0.0851 | RALY-AS1 | 0.894 | -4.962 | -3.126 | -4.451 | 1 | noncoding | -0.334731327 | VHLPLPVEK | n[145]VHLPLPVEK | LVRAMSVSFKLGQLEISPGTFYTKTNGEMFSELQELLKLEGCDSGVARVHLPLPVEKSACDW |
RALY-AS1:5 | BRCA-Luminal A | 13 | 0.128305 | noncoding | 44 | chr20 | 33992487 | 33994355 | - | 0.9999 | RALY-AS1 | 0.876 | -0.949 | -4.387 | -3.237 | 2 | noncoding | -0.350820017 | LPEEAVGGAGGIR | n[145]LPEEAVGGAGGIR | LPEEAVGGAGGIRKRRGRKKLLVLSLLRNVPPRQVFQPPVNQSS |
RALY-AS1:5 | BRCA-Luminal B | 13 | 0.128305 | noncoding | 44 | chr20 | 33992487 | 33994355 | - | 0.9999 | RALY-AS1 | 0.876 | -0.949 | -4.387 | -3.237 | 2 | noncoding | -0.350820017 | LPEEAVGGAGGIR | n[145]LPEEAVGGAGGIR | LPEEAVGGAGGIRKRRGRKKLLVLSLLRNVPPRQVFQPPVNQSS |
RALY-AS1:5 | EOGC | 13 | 0.128305 | noncoding | 44 | chr20 | 33992487 | 33994355 | - | 0.9997 | RALY-AS1 | 0.876 | -0.949 | -4.387 | -3.237 | 8 | noncoding | -0.350820017 | LPEEAVGGAGGIR | n[145]LPEEAVGGAGGIR | LPEEAVGGAGGIRKRRGRKKLLVLSLLRNVPPRQVFQPPVNQSS |
Page 1 of 1
bottom of page