top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
RFX3-AS1:17 | OV | 15 | 0.109151 | noncoding | 56 | chr9 | 3548680 | 3549736 | + | 0.1315 | RFX3-AS1 | 0.032 | -4.099 | -4.184 | -5.686 | 1 | noncoding | -0.422704614 | SVAGQAREYAGGWLR | n[145]SVAGQAREYAGGWLR | MVQSSSLSGGARSVAGQAREYAGGWLRFYGKAYLYYTISRQTPGCVSPGSAESGLQ |
RMDN2-AS1:10 | CCRC | 8 | 0.175508 | noncoding | 64 | chr2 | 38029823 | 38036267 | - | 0.7128 | RMDN2-AS1 | 0.997 | -3.838 | -4.805 | -4.991 | 1 | noncoding | -0.425782153 | MLLGDISR | n[230]MLLGDISR | MLLGDISRISLRLLRMILCDCTKYFLSCILRCCRSYFIIKKTAWELKPRNGIRIIISRQKQATG |
RMST:10 | OSCC | 15 | 0.0163807 | noncoding | 40 | chr12 | 97492636 | 97493980 | + | 0.9877 | RMST | 0.981 | 0 | 0 | 0 | 97 | noncoding | -0.52961591 | LMLLACFSNSFNAIK | n[145]LM[147]LLACFSNSFNAIK | LFLFLHLCLSRKVERLMLLACFSNSFNAIKCTPNLTHSLS |
RMST:10 | OV | 15 | 0.0163807 | noncoding | 40 | chr12 | 97492636 | 97493980 | + | 0.9881 | RMST | 0.981 | 0 | 0 | 0 | 176 | noncoding | -0.52961591 | LMLLACFSNSFNAIK | n[145]LM[147]LLACFSNSFNAIK | LFLFLHLCLSRKVERLMLLACFSNSFNAIKCTPNLTHSLS |
RMST:10 | PRAD | 15 | 0.0163807 | noncoding | 40 | chr12 | 97492636 | 97493980 | + | 0.9206 | RMST | 0.981 | 0 | 0 | 0 | 2 | noncoding | -0.52961591 | LMLLACFSNSFNAIK | LM[147]LLACFSNSFNAIK | LFLFLHLCLSRKVERLMLLACFSNSFNAIKCTPNLTHSLS |
Page 1 of 1
bottom of page