top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC15A4-16:1 | EOGC | 12 | 0.0694376 | noncoding | 68 | chr12 | 128717538 | 128728176 | - | 0.7131 | lnc-SLC15A4-16 | 0.745 | 0 | 0 | 0 | 2 | noncoding | -0.374884656 | ETNSVAFSLWPK | n[145]ETNSVAFSLWPK | MKGSLLERTGSHNYKVKSQDRPFARWGRKKPVVVQLESKSLKIRETNSVAFSLWPKAQEPPANHWYKY |
lnc-SLC15A4-17:1 | OV | 13 | 0.0368523 | noncoding | 38 | chr12 | 128599406 | 128608295 | - | 0.9229 | lnc-SLC15A4-17 | 0.006 | -4.584 | -4.095 | -4.472 | 7 | noncoding | -0.332959412 | LGQSWADQAELER | n[145]LGQSWADQAELER | LGQSWADQAELERLNQPSFNWKFLIRPGMSKMKFSATR |
lnc-SLC15A4-17:1 | OV | 13 | 0.0368523 | noncoding | 68 | chr12 | 128599406 | 128608295 | - | 0.0696 | lnc-SLC15A4-17 | 1 | -2.152 | 1.509 | 2.098 | 1 | noncoding | -0.332959412 | LHSWRGGQTHPLK | n[145]LHSWRGGQTHPLK | LHSWRGGQTHPLKLSAFPEGLSPFQERSEMQSSLETFQERHAPRSTPKTLHFQNITDDRNWICSKACY |
lnc-SLC15A4-17:1 | OV | 13 | 0.0368523 | noncoding | 68 | chr12 | 128599406 | 128608295 | - | 0.1227 | lnc-SLC15A4-17 | 1 | -2.152 | 1.509 | 2.098 | 1 | noncoding | -0.332959412 | SEMQSSLETFQER | n[145]SEM[147]QSSLETFQER | LHSWRGGQTHPLKLSAFPEGLSPFQERSEMQSSLETFQERHAPRSTPKTLHFQNITDDRNWICSKACY |
lnc-SLC15A4-17:1 | OV | 11 | 0.0368523 | noncoding | 68 | chr12 | 128599406 | 128608295 | - | 0.9069 | lnc-SLC15A4-17 | 1 | -2.152 | 1.509 | 2.098 | 6 | noncoding | -0.332959412 | TLHFQNITDDR | n[145]TLHFQNITDDR | LHSWRGGQTHPLKLSAFPEGLSPFQERSEMQSSLETFQERHAPRSTPKTLHFQNITDDRNWICSKACY |
Page 1 of 1
bottom of page