top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC19A1-5:2 | BRCA-Basal-like | 7 | 0.200722 | noncoding | 47 | chr21 | 45582844 | 45590585 | - | 0.9965 | lnc-SLC19A1-5 | 0.047 | -4.465 | -5.029 | -3.717 | 60 | noncoding | -0.322107159 | FIAWGGK | n[145]FIAWGGK | MFLLTEFSRGICKKLLRFIAWGGKLRVVRILYFSCVDCTFYIVCMYL |
lnc-SLC19A1-5:2 | BRCA-Luminal B | 12 | 0.200722 | noncoding | 47 | chr21 | 45582844 | 45590585 | - | 0.1215 | lnc-SLC19A1-5 | 0.047 | -4.465 | -5.029 | -3.717 | 3 | noncoding | -0.322107159 | LLRFIAWGGKLR | n[145]LLRFIAWGGKLR | MFLLTEFSRGICKKLLRFIAWGGKLRVVRILYFSCVDCTFYIVCMYL |
lnc-SLC19A1-5:2 | BRCA-Luminal A | 12 | 0.200722 | noncoding | 47 | chr21 | 45582844 | 45590585 | - | 0.1215 | lnc-SLC19A1-5 | 0.047 | -4.465 | -5.029 | -3.717 | 3 | noncoding | -0.322107159 | LLRFIAWGGKLR | n[145]LLRFIAWGGKLR | MFLLTEFSRGICKKLLRFIAWGGKLRVVRILYFSCVDCTFYIVCMYL |
lnc-SLC19A1-5:2 | CCRC | 7 | 0.200722 | noncoding | 47 | chr21 | 45582844 | 45590585 | - | 0.9999 | lnc-SLC19A1-5 | 0.047 | -4.465 | -5.029 | -3.717 | 59 | noncoding | -0.322107159 | FIAWGGK | n[230]FIAWGGK | MFLLTEFSRGICKKLLRFIAWGGKLRVVRILYFSCVDCTFYIVCMYL |
lnc-SLC19A1-5:2 | EOGC | 16 | 0.200722 | noncoding | 78 | chr21 | 45582844 | 45590585 | - | 0.3422 | lnc-SLC19A1-5 | 0.062 | 0 | 0 | 0 | 1 | noncoding | -0.322107159 | AFPSAPAPFELPGRAR | n[145]AFPSAPAPFELPGRAR | LPLTPPTRAFPSAPAPFELPGRARSSGQPRPRPPRRLQTFLPVRETEGGLFLENQCLRFPPGGLDLKTRPSRGEYATP |
Page 1 of 1
bottom of page