top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC17A5-1:4 | OV | 12 | 0.0323001 | noncoding | 39 | chr6 | 73689714 | 73696021 | - | 0.4032 | lnc-SLC17A5-1 | 0.201 | 0 | 0 | 0 | 4 | noncoding | -0.357745878 | LSPGPNQMDIGR | n[145]LSPGPNQMDIGR | LSPGPNQMDIGRGETRTGREQLVAFLVSLPSHALLPLEK |
lnc-SLC17A9-1:1 | CCRC | 7 | 0.213871 | noncoding | 69 | chr20 | 62969983 | 62973037 | + | 0.9968 | lnc-SLC17A9-1 | 0.432 | -3.455 | 0 | -4.182 | 8 | noncoding | -0.276050121 | GGWQGAK | n[230]GGWQGAK | LAVAVIRCRADRGCRRTGLCRLSELPAKLSPAWDSAWGRSRPLCCERRERVARETYEVEEQRGGWQGAK |
lnc-SLC17A9-1:1 | EOGC | 7 | 0.213871 | noncoding | 69 | chr20 | 62969983 | 62973037 | + | 0.9991 | lnc-SLC17A9-1 | 0.432 | -3.455 | 0 | -4.182 | 38 | noncoding | -0.276050121 | GGWQGAK | n[145]GGWQGAK | LAVAVIRCRADRGCRRTGLCRLSELPAKLSPAWDSAWGRSRPLCCERRERVARETYEVEEQRGGWQGAK |
lnc-SLC17A9-1:1 | HCC | 7 | 0.213871 | noncoding | 69 | chr20 | 62969983 | 62973037 | + | 1 | lnc-SLC17A9-1 | 0.432 | -3.455 | 0 | -4.182 | 53 | noncoding | -0.276050121 | GGWQGAK | n[230]GGWQGAK | LAVAVIRCRADRGCRRTGLCRLSELPAKLSPAWDSAWGRSRPLCCERRERVARETYEVEEQRGGWQGAK |
lnc-SLC17A9-1:1 | LUAD | 7 | 0.213871 | noncoding | 69 | chr20 | 62969983 | 62973037 | + | 0.9999 | lnc-SLC17A9-1 | 0.432 | -3.455 | 0 | -4.182 | 12 | noncoding | -0.276050121 | GGWQGAK | n[230]GGWQGAK | LAVAVIRCRADRGCRRTGLCRLSELPAKLSPAWDSAWGRSRPLCCERRERVARETYEVEEQRGGWQGAK |
Page 1 of 1
bottom of page