top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC25A13-1:1 | BRCA-Luminal B | 12 | 0.124813 | noncoding | 67 | chr7 | 96622005 | 96664338 | - | 0.2754 | lnc-SLC25A13-1 | 0.983 | -5.576 | -5.745 | -5.177 | 3 | noncoding | -0.357738804 | LSCLDLEGHHPK | n[145]LSCLDLEGHHPK | LQNCPKLTLGTKEKKYNLSWKLLKCKINQVRGGLDMEIKLSCLDLEGHHPKENGHVLTDEIFRIPDR |
lnc-SLC25A15-4:1 | EOGC | 18 | 0.00958218 | noncoding | 45 | chr13 | 40904925 | 40905687 | + | 0.0502 | lnc-SLC25A15-4 | 0.196 | -4.967 | -5.345 | -4.316 | 1 | noncoding | -0.351824692 | AQLPFSMTQTNLILFHNR | n[145]AQLPFSM[147]TQTNLILFHNR | LHFLLQPSEPVSFLKAQLPFSMTQTNLILFHNRKFHMSLELQVNK |
lnc-SLC25A15-4:1 | EOGC | 11 | 0.00958218 | noncoding | 45 | chr13 | 40904925 | 40905687 | + | 0.9997 | lnc-SLC25A15-4 | 0.196 | -4.967 | -5.345 | -4.316 | 11 | noncoding | -0.351824692 | FHMSLELQVNK | n[145]FHM[147]SLELQVNK | LHFLLQPSEPVSFLKAQLPFSMTQTNLILFHNRKFHMSLELQVNK |
lnc-SLC25A15-4:1 | EOGC | 11 | 0.00958218 | noncoding | 45 | chr13 | 40904925 | 40905687 | + | 0.9997 | lnc-SLC25A15-4 | 0.196 | -4.967 | -5.345 | -4.316 | 11 | noncoding | -0.351824692 | FHMSLELQVNK | n[145]FHMSLELQVNK | LHFLLQPSEPVSFLKAQLPFSMTQTNLILFHNRKFHMSLELQVNK |
lnc-SLC25A15-9:1 | CCRC | 7 | 0.118106 | noncoding | 42 | chr13 | 40539404 | 40542232 | + | 0.9984 | lnc-SLC25A15-9 | 0.625 | 0 | 0 | 0 | 13 | noncoding | -0.332557266 | GVTCTLR | n[230]GVTCTLR | MGVTCTLRKTLRIHIKKSNVLPGIMAHACNPSTLGGRGRQIT |
Page 1 of 1
bottom of page