top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC25A51-4:2 | OSCC | 8 | 0.153842 | noncoding | 86 | chr9 | 37910723 | 37912141 | - | 0.0873 | lnc-SLC25A51-4 | 0.736 | -3.997 | -5.143 | -4.333 | 1 | noncoding | -0.309787168 | SGVYFINK | n[145]SGVYFINK | MAEASVATGFQSKEGLGCQKGFLWEARSGVYFINKKCSSLTGHLLKLRPQLLRSSSSPAGRPRAVLTEFSPSPFSASSNIPSFSVI |
lnc-SLC26A3-1:13 | OV | 17 | 0.107892 | noncoding | 34 | chr7 | 107736007 | 107744025 | - | 0.9768 | lnc-SLC26A3-1 | 0.142 | 0 | 0 | 0 | 16 | noncoding | -0.318330646 | LAISPSMQSAQPGALLK | n[145]LAISPSMQSAQPGALLK | LAISPSMQSAQPGALLKVLPSRKISLHHCPSGMS |
lnc-SLC26A8-1:7 | OSCC | 11 | 0.149297 | noncoding | 48 | chr6 | 36139292 | 36196646 | - | 0.7571 | lnc-SLC26A8-1 | 1 | -1.807 | -0.974 | -3.369 | 12 | noncoding | -0.305814613 | EQNGLPSSQAR | n[145]EQNGLPSSQAR | LESCAISQREQNGLPSSQARAHFCLCSSQSPSLLLFHILIAYHSPKIT |
lnc-SLC19A1-5:2 | OV | 8 | 0.200722 | noncoding | 78 | chr21 | 45582844 | 45590585 | - | 0.9983 | lnc-SLC19A1-5 | 0.062 | 0 | 0 | 0 | 1 | noncoding | -0.322107159 | LQTFLPVR | n[145]LQTFLPVR | LPLTPPTRAFPSAPAPFELPGRARSSGQPRPRPPRRLQTFLPVRETEGGLFLENQCLRFPPGGLDLKTRPSRGEYATP |
lnc-SLC19A1-5:2 | PRAD | 7 | 0.200722 | noncoding | 47 | chr21 | 45582844 | 45590585 | - | 0.9965 | lnc-SLC19A1-5 | 0.047 | -4.465 | -5.029 | -3.717 | 19 | noncoding | -0.322107159 | FIAWGGK | MFLLTEFSRGICKKLLRFIAWGGKLRVVRILYFSCVDCTFYIVCMYL |
Page 1 of 1
bottom of page