top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC25A48-7:2 | EOGC | 11 | 0.0676918 | noncoding | 63 | chr5 | 135456429 | 135458868 | + | 0.9999 | lnc-SLC25A48-7 | 0.077 | -4.4 | -5.378 | -5.11 | 36 | noncoding | -0.392769235 | WELEVSRRESK | n[145]WELEVSRRESK | LPSLHLSEARRNAPGLWVGVCIHSAGCWLSGGRWELEVSRRESKSPKGKSWGSAGFTQPGSLG |
lnc-SLC25A48-8:3 | OV | 11 | 0.0537062 | noncoding | 48 | chr5 | 135399888 | 135402615 | + | 0.9809 | lnc-SLC25A48-8 | 0.993 | -5.334 | -5.356 | -4.104 | 39 | noncoding | -0.366604548 | MTGSFHSFSRK | n[145]MTGSFHSFSRK | MTGSFHSFSRKCLPQTKDHIMTFMGHRHFCLHGPFPPLKRQLHWYKDK |
lnc-SLC25A48-8:3 | OV | 11 | 0.0537062 | noncoding | 48 | chr5 | 135399888 | 135402615 | + | 0.9809 | lnc-SLC25A48-8 | 0.993 | -5.334 | -5.356 | -4.104 | 39 | noncoding | -0.366604548 | MTGSFHSFSRK | n[145]M[147]TGSFHSFSRK | MTGSFHSFSRKCLPQTKDHIMTFMGHRHFCLHGPFPPLKRQLHWYKDK |
lnc-SLC25A51-4:2 | BRCA-Luminal A | 12 | 0.153842 | noncoding | 86 | chr9 | 37910723 | 37912141 | - | 0.7058 | lnc-SLC25A51-4 | 0.736 | -3.997 | -5.143 | -4.333 | 1 | noncoding | -0.309787168 | AEASVATGFQSK | n[145]AEASVATGFQSK | MAEASVATGFQSKEGLGCQKGFLWEARSGVYFINKKCSSLTGHLLKLRPQLLRSSSSPAGRPRAVLTEFSPSPFSASSNIPSFSVI |
lnc-SLC25A51-4:2 | BRCA-HER2-enriched | 13 | 0.153842 | noncoding | 86 | chr9 | 37910723 | 37912141 | - | 0.2977 | lnc-SLC25A51-4 | 0.736 | -3.997 | -5.143 | -4.333 | 3 | noncoding | -0.309787168 | MAEASVATGFQSK | n[145]M[147]AEASVATGFQSK | MAEASVATGFQSKEGLGCQKGFLWEARSGVYFINKKCSSLTGHLLKLRPQLLRSSSSPAGRPRAVLTEFSPSPFSASSNIPSFSVI |
Page 1 of 1
bottom of page