top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC25A28-1:2 | BRCA-HER2-enriched | 8 | 0.149437 | noncoding | 46 | chr10 | 99644512 | 99659249 | - | 0.9969 | lnc-SLC25A28-1 | 0.648 | 0 | 0 | 0 | 8 | noncoding | -0.311814837 | LLTNPQLK | n[145]LLTNPQLK | LEWTSSKLLTNPQLKVLTVRRKTNKQKGHPHQNPICTSPSSKTKGR |
lnc-SLC25A28-1:2 | BRCA-Luminal A | 8 | 0.149437 | noncoding | 46 | chr10 | 99644512 | 99659249 | - | 0.9969 | lnc-SLC25A28-1 | 0.648 | 0 | 0 | 0 | 8 | noncoding | -0.311814837 | LLTNPQLK | n[145]LLTNPQLK | LEWTSSKLLTNPQLKVLTVRRKTNKQKGHPHQNPICTSPSSKTKGR |
lnc-SLC25A28-1:2 | EOGC | 8 | 0.149437 | noncoding | 46 | chr10 | 99644512 | 99659249 | - | 0.9981 | lnc-SLC25A28-1 | 0.648 | 0 | 0 | 0 | 51 | noncoding | -0.311814837 | LLTNPQLK | n[145]LLTNPQLK | LEWTSSKLLTNPQLKVLTVRRKTNKQKGHPHQNPICTSPSSKTKGR |
lnc-SLC25A28-1:2 | EOGC | 8 | 0.149437 | noncoding | 126 | chr10 | 99644512 | 99659249 | - | 0.6426 | lnc-SLC25A28-1 | 0.524 | 0 | 0 | 0 | 1 | noncoding | -0.311814837 | LTADLSQK | n[145]LTADLSQK | LIGVPESDGENGTKLENTLQDIIQENFPNLARQANIQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRVTHKGKPIKLTADLSQKLYKPEESGGQYSTFLKKRIFNPEFHIQPN |
lnc-SLC25A28-1:2 | OSCC | 8 | 0.149437 | noncoding | 46 | chr10 | 99644512 | 99659249 | - | 0.9955 | lnc-SLC25A28-1 | 0.648 | 0 | 0 | 0 | 3 | noncoding | -0.311814837 | LLTNPQLK | n[145]LLTNPQLK | LEWTSSKLLTNPQLKVLTVRRKTNKQKGHPHQNPICTSPSSKTKGR |
Page 1 of 1
bottom of page