top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SIX3-AS1:10 | OV | 14 | 0.112867 | noncoding | 90 | chr2 | 44940261 | 44941487 | - | 0.7757 | SIX3-AS1 | 1 | 0 | -2.862 | -2.392 | 54 | noncoding | -0.350371649 | SWGPPSTDLGPAGR | n[145]SWGPPSTDLGPAGR | MRSWGPPSTDLGPAGRGASRGSRIPRNSAASLRSGGGAAGAEKPKSPLDPEKSYRCPLLTTQQKELWSCLPAPEGTQTLEASHPDEVNKA |
RPARP-AS1:1 | BRCA-Basal-like | 11 | 0.134808 | noncoding | 42 | chr10 | 102438135 | 102456289 | + | 0.9957 | RPARP-AS1 | 0.16 | -5.667 | -5.222 | 0 | 27 | noncoding | -0.344061563 | VLDSCLQFELR | n[145]VLDSCLQFELR | MDWATGKAGAGPGGGGHQVRAWRPRPRWELRVLDSCLQFELR |
RPARP-AS1:1 | BRCA-Luminal A | 11 | 0.134808 | noncoding | 42 | chr10 | 102438135 | 102456289 | + | 0.9957 | RPARP-AS1 | 0.16 | -5.667 | -5.222 | 0 | 27 | noncoding | -0.344061563 | VLDSCLQFELR | n[145]VLDSCLQFELR | MDWATGKAGAGPGGGGHQVRAWRPRPRWELRVLDSCLQFELR |
RPARP-AS1:1 | BRCA-Luminal B | 11 | 0.134808 | noncoding | 42 | chr10 | 102438135 | 102456289 | + | 0.9957 | RPARP-AS1 | 0.16 | -5.667 | -5.222 | 0 | 27 | noncoding | -0.344061563 | VLDSCLQFELR | n[145]VLDSCLQFELR | MDWATGKAGAGPGGGGHQVRAWRPRPRWELRVLDSCLQFELR |
RPARP-AS1:1 | BRCA-HER2-enriched | 11 | 0.134808 | noncoding | 42 | chr10 | 102438135 | 102456289 | + | 0.9957 | RPARP-AS1 | 0.16 | -5.667 | -5.222 | 0 | 27 | noncoding | -0.344061563 | VLDSCLQFELR | n[145]VLDSCLQFELR | MDWATGKAGAGPGGGGHQVRAWRPRPRWELRVLDSCLQFELR |
Page 1 of 1
bottom of page