top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC35C1-2:1 | CCRC | 14 | 0.187913 | noncoding | 74 | chr11 | 45651325 | 45652805 | + | 0.7036 | lnc-SLC35C1-2 | 1 | -2.318 | -1.857 | -2.303 | 14 | noncoding | -0.360463222 | LQTMVGELPARPGK | n[230]LQTM[147]VGELPARPGK | LQTMVGELPARPGKVDNCVKPLPTHGCSDSPGSGLAEVSKGRGAYPGLQVERAPPGMQLGRKSSSNHTEVTPAT |
lnc-SLC35C1-2:1 | EOGC | 14 | 0.187913 | noncoding | 74 | chr11 | 45651325 | 45652805 | + | 0.9089 | lnc-SLC35C1-2 | 1 | -2.318 | -1.857 | -2.303 | 3 | noncoding | -0.360463222 | LQTMVGELPARPGK | n[145]LQTMVGELPARPGK | LQTMVGELPARPGKVDNCVKPLPTHGCSDSPGSGLAEVSKGRGAYPGLQVERAPPGMQLGRKSSSNHTEVTPAT |
lnc-SLC35C1-2:1 | EOGC | 14 | 0.187913 | noncoding | 74 | chr11 | 45651325 | 45652805 | + | 0.9089 | lnc-SLC35C1-2 | 1 | -2.318 | -1.857 | -2.303 | 3 | noncoding | -0.360463222 | LQTMVGELPARPGK | n[145]LQTM[147]VGELPARPGK | LQTMVGELPARPGKVDNCVKPLPTHGCSDSPGSGLAEVSKGRGAYPGLQVERAPPGMQLGRKSSSNHTEVTPAT |
lnc-SLC35C1-8:1 | BRCA-Basal-like | 10 | 0.129883 | noncoding | 47 | chr11 | 45671918 | 45701020 | + | 0.9974 | lnc-SLC35C1-8 | 0.866 | -3.798 | -4.715 | -5.016 | 38 | noncoding | -0.312209276 | GGPGTSPSAR | n[145]GGPGTSPSAR | MPVASRGGPGTSPSARLMLTPPQDSPLVIAVGLLGHRFSQDGLGYPA |
lnc-SLC35C1-8:1 | BRCA-Luminal A | 10 | 0.129883 | noncoding | 47 | chr11 | 45671918 | 45701020 | + | 0.9974 | lnc-SLC35C1-8 | 0.866 | -3.798 | -4.715 | -5.016 | 38 | noncoding | -0.312209276 | GGPGTSPSAR | n[145]GGPGTSPSAR | MPVASRGGPGTSPSARLMLTPPQDSPLVIAVGLLGHRFSQDGLGYPA |
Page 1 of 1
bottom of page