top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC2A12-11:1 | CCRC | 7 | 0.145443 | noncoding | 100 | chr6 | 133510385 | 133510693 | - | 0.8799 | lnc-SLC2A12-11 | 1 | -4.63 | -4.525 | -5.131 | 2 | noncoding | -0.362895524 | LAGQVFR | n[230]LAGQVFR | LAGQVFRKCLPLFDQVLAERSAVQTVTKGGIMLPEKHPVKALQAMIVTAGLGFKEKSGEILPISIRVGNKVFLPEYGGTKVVLNDEIISYLEMVTYLESP |
lnc-SLC2A12-11:1 | EOGC | 14 | 0.145443 | noncoding | 100 | chr6 | 133510385 | 133510693 | - | 0.1041 | lnc-SLC2A12-11 | 1 | -4.63 | -4.525 | -5.131 | 2 | noncoding | -0.362895524 | ALQAMIVTAGLGFK | n[145]ALQAM[147]IVTAGLGFK | LAGQVFRKCLPLFDQVLAERSAVQTVTKGGIMLPEKHPVKALQAMIVTAGLGFKEKSGEILPISIRVGNKVFLPEYGGTKVVLNDEIISYLEMVTYLESP |
lnc-SLC2A12-11:1 | EOGC | 14 | 0.145443 | noncoding | 100 | chr6 | 133510385 | 133510693 | - | 0.1041 | lnc-SLC2A12-11 | 1 | -4.63 | -4.525 | -5.131 | 2 | noncoding | -0.362895524 | ALQAMIVTAGLGFK | n[145]ALQAMIVTAGLGFK | LAGQVFRKCLPLFDQVLAERSAVQTVTKGGIMLPEKHPVKALQAMIVTAGLGFKEKSGEILPISIRVGNKVFLPEYGGTKVVLNDEIISYLEMVTYLESP |
lnc-SLC2A12-11:1 | EOGC | 7 | 0.145443 | noncoding | 100 | chr6 | 133510385 | 133510693 | - | 0.9967 | lnc-SLC2A12-11 | 1 | -4.63 | -4.525 | -5.131 | 219 | noncoding | -0.362895524 | LAGQVFR | n[145]LAGQVFR | LAGQVFRKCLPLFDQVLAERSAVQTVTKGGIMLPEKHPVKALQAMIVTAGLGFKEKSGEILPISIRVGNKVFLPEYGGTKVVLNDEIISYLEMVTYLESP |
lnc-SLC2A12-11:1 | EOGC | 20 | 0.145443 | noncoding | 100 | chr6 | 133510385 | 133510693 | - | 0.097 | lnc-SLC2A12-11 | 1 | -4.63 | -4.525 | -5.131 | 1 | noncoding | -0.362895524 | VVLNDEIISYLEMVTYLESP | n[145]VVLNDEIISYLEMVTYLESP | LAGQVFRKCLPLFDQVLAERSAVQTVTKGGIMLPEKHPVKALQAMIVTAGLGFKEKSGEILPISIRVGNKVFLPEYGGTKVVLNDEIISYLEMVTYLESP |
Page 1 of 1
bottom of page