top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SLC39A10-11:1 | CRC | 15 | 0.0890651 | noncoding | 34 | chr2 | 194562431 | 194576453 | + | 0.6226 | lnc-SLC39A10-11 | 0.035 | -5.777 | -5.986 | -6.129 | 1 | noncoding | -0.445466906 | KCTSVSVSPLYYAFK | KCTSVSVSPLYYAFK | LTSPYTISVSKVLPKPLRKCTSVSVSPLYYAFKS |
lnc-SLC39A10-11:1 | OV | 21 | 0.0890651 | noncoding | 55 | chr2 | 194562431 | 194576453 | + | 0.5873 | lnc-SLC39A10-11 | 0.112 | 0 | 0 | 0 | 1 | noncoding | -0.445466906 | DLLCLAFHHDCEDSPATCNCK | n[145]DLLCLAFHHDCEDSPATCNCK | LWVLKMGLSPHKLSLCLPAAIHVRRDLLCLAFHHDCEDSPATCNCKSIKPLSTED |
lnc-SLC39A10-11:1 | OV | 12 | 0.0890651 | noncoding | 55 | chr2 | 194562431 | 194576453 | + | 0.6009 | lnc-SLC39A10-11 | 0.112 | 0 | 0 | 0 | 2 | noncoding | -0.445466906 | LSLCLPAAIHVR | n[145]LSLCLPAAIHVR | LWVLKMGLSPHKLSLCLPAAIHVRRDLLCLAFHHDCEDSPATCNCKSIKPLSTED |
lnc-SLC39A11-1:3 | BRCA-Luminal B | 7 | 0.158627 | noncoding | 55 | chr17 | 72384301 | 72592804 | - | 0.9978 | lnc-SLC39A11-1 | 0.157 | -3.261 | -1.536 | -4.875 | 9 | noncoding | -0.319591698 | GRFTFSR | n[145]GRFTFSR | LWNSYIPQTRYAPQSLGILSKGRFTFSRSRVGGLTFGTSHKLPGDADGAGPWTPS |
lnc-SLC39A11-1:3 | BRCA-Basal-like | 7 | 0.158627 | noncoding | 55 | chr17 | 72384301 | 72592804 | - | 0.9978 | lnc-SLC39A11-1 | 0.157 | -3.261 | -1.536 | -4.875 | 9 | noncoding | -0.319591698 | GRFTFSR | n[145]GRFTFSR | LWNSYIPQTRYAPQSLGILSKGRFTFSRSRVGGLTFGTSHKLPGDADGAGPWTPS |
Page 1 of 1
bottom of page