top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SMAD7-1:3 | BRCA-Luminal B | 16 | 0.141795 | noncoding | 38 | chr18 | 48961067 | 48976543 | - | 0.9995 | lnc-SMAD7-1 | 0.164 | -3.137 | -4.032 | -4.191 | 94 | noncoding | -0.369366693 | HAPIPKPMSSGSSSWK | n[145]HAPIPKPM[147]SSGSSSWK | MGIGQWGLRPYLPREGEDLGRHAPIPKPMSSGSSSWKS |
lnc-SMAD7-1:3 | BRCA-Basal-like | 16 | 0.141795 | noncoding | 38 | chr18 | 48961067 | 48976543 | - | 0.9995 | lnc-SMAD7-1 | 0.164 | -3.137 | -4.032 | -4.191 | 94 | noncoding | -0.369366693 | HAPIPKPMSSGSSSWK | n[145]HAPIPKPM[147]SSGSSSWK | MGIGQWGLRPYLPREGEDLGRHAPIPKPMSSGSSSWKS |
lnc-SMAD7-1:3 | PRAD | 16 | 0.141795 | noncoding | 46 | chr18 | 48961067 | 48976543 | - | 0.9963 | lnc-SMAD7-1 | 0.651 | 0 | 0 | 0 | 2 | noncoding | -0.369366693 | NSLLWSGSGPLSCNRR | NSLLWSGSGPLSCNRR | LWTCPEFFLMRDPKNSLLWSGSGPLSCNRRKMAYLGPNELRVPLRY |
lnc-SMAD7-2:2 | BRCA-Luminal A | 9 | 0.533467 | coding | 88 | chr18 | 48812915 | 48834821 | - | 0.5161 | lnc-SMAD7-2 | 1 | -4.433 | -0.364 | 12.753 | 1 | noncoding | -0.313201066 | GLGATLLCR | n[145]GLGATLLCR | MGHTSTRKGSPVLLRMVPKTSHRKVMKPSQRSTSCCCSSSRTVKSFCGGMRDRVSLPGLGRGLGATLLCRASVVLGLLLGSRQTPCFK |
lnc-SMAD7-2:2 | BRCA-Basal-like | 8 | 0.533467 | coding | 88 | chr18 | 48812915 | 48834821 | - | 0.7796 | lnc-SMAD7-2 | 1 | -4.433 | -0.364 | 12.753 | 2 | noncoding | -0.313201066 | VSLPGLGR | n[145]VSLPGLGR | MGHTSTRKGSPVLLRMVPKTSHRKVMKPSQRSTSCCCSSSRTVKSFCGGMRDRVSLPGLGRGLGATLLCRASVVLGLLLGSRQTPCFK |
Page 1 of 1
bottom of page