top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SMIM17-5:4 | OSCC | 10 | 0.0503743 | noncoding | 44 | chr19 | 56671978 | 56675326 | + | 0.8791 | lnc-SMIM17-5 | 0.524 | 0 | 0 | 0 | 2 | noncoding | -0.328488242 | VAQTGLAPEK | n[145]VAQTGLAPEK | LLGLSPVWEPRMRERVAQTGLAPEKSRGTDGAGLRSQDIACRGR |
lnc-SMIM17-5:4 | OSCC | 20 | 0.0503743 | noncoding | 44 | chr19 | 56671978 | 56675326 | + | 0.1103 | lnc-SMIM17-5 | 0.524 | 0 | 0 | 0 | 1 | noncoding | -0.328488242 | VAQTGLAPEKSRGTDGAGLR | n[145]VAQTGLAPEKSRGTDGAGLR | LLGLSPVWEPRMRERVAQTGLAPEKSRGTDGAGLRSQDIACRGR |
lnc-SMIM17-5:4 | OV | 17 | 0.0503743 | noncoding | 54 | chr19 | 56671978 | 56675326 | + | 0.6763 | lnc-SMIM17-5 | 0.259 | 0 | 0 | 0 | 1 | noncoding | -0.328488242 | LVLSGDGTLMPSAHFAK | n[145]LVLSGDGTLMPSAHFAK | LVLSGDGTLMPSAHFAKMKKFMTLLPWLLSMLAWPPGVGGTSSLLAEAGESFIF |
lnc-SMIM17-5:4 | OV | 19 | 0.0503743 | noncoding | 54 | chr19 | 56671978 | 56675326 | + | 0.265 | lnc-SMIM17-5 | 0.259 | 0 | 0 | 0 | 3 | noncoding | -0.328488242 | LVLSGDGTLMPSAHFAKMK | n[145]LVLSGDGTLMPSAHFAKM[147]K | LVLSGDGTLMPSAHFAKMKKFMTLLPWLLSMLAWPPGVGGTSSLLAEAGESFIF |
lnc-SMIM17-5:4 | OV | 19 | 0.0503743 | noncoding | 54 | chr19 | 56671978 | 56675326 | + | 0.265 | lnc-SMIM17-5 | 0.259 | 0 | 0 | 0 | 3 | noncoding | -0.328488242 | LVLSGDGTLMPSAHFAKMK | n[145]LVLSGDGTLM[147]PSAHFAKM[147]K | LVLSGDGTLMPSAHFAKMKKFMTLLPWLLSMLAWPPGVGGTSSLLAEAGESFIF |
Page 1 of 1
bottom of page