top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SNCB-1:1 | OV | 10 | 0.450168 | noncoding | 94 | chr5 | 176707355 | 176726243 | - | 0.994 | lnc-SNCB-1 | 1 | -3.839 | -2.303 | -0.774 | 37 | noncoding | -0.375043718 | FTESSLQMLR | n[145]FTESSLQM[147]LR | MWGKSKFTESSLQMLRGWCLRQGRWMTRNYPPGSPSLTPLPPAWSPSNFRLFVHPEQRLCTISLAGRSGFQGLLTAGWAPGLLGPSLSSLRRAF |
lnc-SNCB-1:1 | OV | 10 | 0.450168 | noncoding | 94 | chr5 | 176707355 | 176726243 | - | 0.994 | lnc-SNCB-1 | 1 | -3.839 | -2.303 | -0.774 | 37 | noncoding | -0.375043718 | FTESSLQMLR | n[145]FTESSLQMLR | MWGKSKFTESSLQMLRGWCLRQGRWMTRNYPPGSPSLTPLPPAWSPSNFRLFVHPEQRLCTISLAGRSGFQGLLTAGWAPGLLGPSLSSLRRAF |
lnc-SMIM2-3:1 | OV | 20 | 0.217273 | noncoding | 43 | chr13 | 44260969 | 44262930 | - | 0.6057 | lnc-SMIM2-3 | 0.025 | -3.867 | -3.535 | -5.147 | 7 | noncoding | -0.342484122 | MLSCVVEVYAWTLIDASPSK | n[145]M[147]LSCVVEVYAWTLIDASPSK | MLSCVVEVYAWTLIDASPSKGSFHSCCFWLDGALTVLSTSGRD |
lnc-SMIM28-1:1 | OSCC | 9 | 0.0907209 | noncoding | 34 | chr6 | 138340184 | 138344611 | + | 0.9962 | lnc-SMIM28-1 | 0.398 | -6.104 | 0 | -4.648 | 7 | noncoding | -0.401138153 | KTFDSNSKR | n[145]KTFDSNSKR | MKTFDSNSKRLQIAGRRRVVNVTVIANPYLYYHT |
lnc-SMIM28-1:1 | OV | 9 | 0.0907209 | noncoding | 34 | chr6 | 138340184 | 138344611 | + | 0.9919 | lnc-SMIM28-1 | 0.398 | -6.104 | 0 | -4.648 | 2 | noncoding | -0.401138153 | KTFDSNSKR | n[145]KTFDSNSKR | MKTFDSNSKRLQIAGRRRVVNVTVIANPYLYYHT |
Page 1 of 1
bottom of page