top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SNW1-6:1 | EOGC | 9 | 0.0866406 | noncoding | 57 | chr14 | 77683201 | 77683989 | - | 0.8216 | lnc-SNW1-6 | 1 | 0 | 0 | 0 | 3 | noncoding | -0.338311753 | GMGMGTVQK | n[145]GM[147]GM[147]GTVQK | LAMYMRICKRDDIVDVVDIKGMGMGTVQKGMAHKCCHGKTGRVYSVPQHAVSIVVNK |
lnc-SNW1-6:1 | EOGC | 15 | 0.0866406 | noncoding | 57 | chr14 | 77683201 | 77683989 | - | 0.9955 | lnc-SNW1-6 | 1 | 0 | 0 | 0 | 5 | noncoding | -0.338311753 | VYSVPQHAVSIVVNK | n[145]VYSVPQHAVSIVVNK | LAMYMRICKRDDIVDVVDIKGMGMGTVQKGMAHKCCHGKTGRVYSVPQHAVSIVVNK |
lnc-SNW1-6:1 | HCC | 10 | 0.0866406 | noncoding | 57 | chr14 | 77683201 | 77683989 | - | 0.1135 | lnc-SNW1-6 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.338311753 | DDIVDVVDIK | n[230]DDIVDVVDIK | LAMYMRICKRDDIVDVVDIKGMGMGTVQKGMAHKCCHGKTGRVYSVPQHAVSIVVNK |
lnc-SNW1-6:1 | HCC | 9 | 0.0866406 | noncoding | 57 | chr14 | 77683201 | 77683989 | - | 0.8404 | lnc-SNW1-6 | 1 | 0 | 0 | 0 | 7 | noncoding | -0.338311753 | GMGMGTVQK | GMGMGTVQK | LAMYMRICKRDDIVDVVDIKGMGMGTVQKGMAHKCCHGKTGRVYSVPQHAVSIVVNK |
lnc-SNW1-6:1 | HCC | 11 | 0.0866406 | noncoding | 57 | chr14 | 77683201 | 77683989 | - | 0.8512 | lnc-SNW1-6 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.338311753 | RDDIVDVVDIK | n[230]RDDIVDVVDIK | LAMYMRICKRDDIVDVVDIKGMGMGTVQKGMAHKCCHGKTGRVYSVPQHAVSIVVNK |
Page 1 of 1
bottom of page