top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SORCS1-10:1 | HCC | 11 | 0.342613 | noncoding | 82 | chr10 | 105685382 | 105685865 | - | 0.783 | lnc-SORCS1-10 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.379871898 | MAVVASPSMGR | n[230]M[147]AVVASPSMGR | MAVVASPSMGRNLMMRILKHTGPGILSMTNVGPNTNSFQCFICTATTEWLDGKHIVFGKVKEGMNIMEAREHFGSRNGKTSK |
lnc-SORCS1-9:2 | OV | 10 | 0.0372077 | noncoding | 33 | chr10 | 105798764 | 105809187 | - | 0.9808 | lnc-SORCS1-9 | 1 | -4.613 | -3.288 | -4.39 | 7 | noncoding | -0.434954672 | LIFIPMAAIR | n[145]LIFIPMAAIR | LIFIPMAAIRKRQELCVLSFISFLCSSGKIEPI |
lnc-SORCS1-9:2 | OV | 18 | 0.0372077 | noncoding | 33 | chr10 | 105798764 | 105809187 | - | 0.4239 | lnc-SORCS1-9 | 1 | -4.613 | -3.288 | -4.39 | 4 | noncoding | -0.434954672 | RQELCVLSFISFLCSSGK | n[145]RQELCVLSFISFLCSSGK | LIFIPMAAIRKRQELCVLSFISFLCSSGKIEPI |
lnc-SORCS2-4:1 | BRCA-Luminal B | 9 | 0.96916 | coding | 37 | chr4 | 7939000 | 7940295 | + | 0.9985 | lnc-SORCS2-4 | 0.996 | -6.077 | -3.434 | -3.569 | 60 | noncoding | -0.246307735 | ARERLALQK | n[145]ARERLALQK | LESALQDALISNPELRLLGQRARERLALQKGKLRSKE |
lnc-SORCS2-4:1 | BRCA-HER2-enriched | 9 | 0.96916 | coding | 37 | chr4 | 7939000 | 7940295 | + | 0.9985 | lnc-SORCS2-4 | 0.996 | -6.077 | -3.434 | -3.569 | 60 | noncoding | -0.246307735 | ARERLALQK | n[145]ARERLALQK | LESALQDALISNPELRLLGQRARERLALQKGKLRSKE |
Page 1 of 1
bottom of page