top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SLC25A25-AS1:8 | BRCA-Luminal B | 8 | 0.21749 | noncoding | 66 | chr9 | 128108580 | 128118693 | - | 0.9993 | SLC25A25-AS1 | 0.43 | 0 | 0 | 0 | 29 | noncoding | -0.316885885 | LEDLSDMR | n[145]LEDLSDMR | LEDLSDMRNLGFLFLRQSLTLSPRLECSGMISAHHNLCLLGSSHSPASASGVAGIIGTCHHTWLST |
SLC25A25-AS1:8 | BRCA-Basal-like | 8 | 0.21749 | noncoding | 66 | chr9 | 128108580 | 128118693 | - | 0.9993 | SLC25A25-AS1 | 0.43 | 0 | 0 | 0 | 29 | noncoding | -0.316885885 | LEDLSDMR | n[145]LEDLSDMR | LEDLSDMRNLGFLFLRQSLTLSPRLECSGMISAHHNLCLLGSSHSPASASGVAGIIGTCHHTWLST |
SLC25A25-AS1:8 | BRCA-Basal-like | 16 | 0.21749 | noncoding | 66 | chr9 | 128108580 | 128118693 | - | 0.2608 | SLC25A25-AS1 | 0.43 | 0 | 0 | 0 | 1 | noncoding | -0.316885885 | LEDLSDMRNLGFLFLR | n[145]LEDLSDMRNLGFLFLR | LEDLSDMRNLGFLFLRQSLTLSPRLECSGMISAHHNLCLLGSSHSPASASGVAGIIGTCHHTWLST |
SLC25A25-AS1:8 | CCRC | 8 | 0.21749 | noncoding | 66 | chr9 | 128108580 | 128118693 | - | 0.9961 | SLC25A25-AS1 | 0.43 | 0 | 0 | 0 | 6 | noncoding | -0.316885885 | LEDLSDMR | n[230]LEDLSDMR | LEDLSDMRNLGFLFLRQSLTLSPRLECSGMISAHHNLCLLGSSHSPASASGVAGIIGTCHHTWLST |
SLC25A25-AS1:8 | EOGC | 8 | 0.21749 | noncoding | 66 | chr9 | 128108580 | 128118693 | - | 0.9983 | SLC25A25-AS1 | 0.43 | 0 | 0 | 0 | 3 | noncoding | -0.316885885 | LEDLSDMR | n[145]LEDLSDMR | LEDLSDMRNLGFLFLRQSLTLSPRLECSGMISAHHNLCLLGSSHSPASASGVAGIIGTCHHTWLST |
Page 1 of 1
bottom of page