top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SPAG1-8:1 | EOGC | 11 | 0.230245 | noncoding | 45 | chr8 | 100722495 | 100725485 | + | 0.9982 | lnc-SPAG1-8 | 1 | 3.013 | 0.146 | 1.979 | 93 | noncoding | -0.320858947 | CLLGAGVPNGR | n[145]CLLGAGVPNGR | MEPAWPPALSYPDRTTSPSRHRRHARRPQKRCLLGAGVPNGRGAR |
lnc-SPAG1-8:1 | EOGC | 13 | 0.230245 | noncoding | 45 | chr8 | 100722495 | 100725485 | + | 0.6372 | lnc-SPAG1-8 | 1 | 3.013 | 0.146 | 1.979 | 6 | noncoding | -0.320858947 | EPAWPPALSYPDR | n[145]EPAWPPALSYPDR | MEPAWPPALSYPDRTTSPSRHRRHARRPQKRCLLGAGVPNGRGAR |
lnc-SPAG1-8:1 | OV | 11 | 0.230245 | noncoding | 45 | chr8 | 100722495 | 100725485 | + | 0.9911 | lnc-SPAG1-8 | 1 | 3.013 | 0.146 | 1.979 | 47 | noncoding | -0.320858947 | CLLGAGVPNGR | n[145]CLLGAGVPNGR | MEPAWPPALSYPDRTTSPSRHRRHARRPQKRCLLGAGVPNGRGAR |
lnc-SPAG1-8:1 | OV | 13 | 0.230245 | noncoding | 45 | chr8 | 100722495 | 100725485 | + | 0.8296 | lnc-SPAG1-8 | 1 | 3.013 | 0.146 | 1.979 | 4 | noncoding | -0.320858947 | EPAWPPALSYPDR | n[145]EPAWPPALSYPDR | MEPAWPPALSYPDRTTSPSRHRRHARRPQKRCLLGAGVPNGRGAR |
lnc-SPAG4-2:1 | OV | 8 | 0.0297895 | noncoding | 43 | chr20 | 35588323 | 35588607 | + | 0.9998 | lnc-SPAG4-2 | 1 | 0 | 0 | 0 | 3 | noncoding | -0.358251603 | DKTHTLCR | n[145]DKTHTLCR | MTKETSSFGKHRDKTHTLCRHCGSMACQLQKSTCGKRGYPAKH |
Page 1 of 1
bottom of page