top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SPATA16-5:1 | EOGC | 8 | 0.0317833 | noncoding | 56 | chr3 | 174073406 | 174077277 | - | 0.9978 | lnc-SPATA16-5 | 0.763 | -4.861 | -5.279 | -6.177 | 11 | noncoding | -0.390818964 | LMLQTFPK | n[145]LMLQTFPK | MLPLHWIPNKLMLQTFPKEFYSQAFQCTDTLPAYCNRLLSASVSDKPFSTFILDES |
lnc-SPATA17-2:1 | BRCA-Luminal B | 11 | 0.0246736 | noncoding | 52 | chr1 | 217491974 | 217494283 | + | 0.9959 | lnc-SPATA17-2 | 1 | -5.404 | -5.348 | -3.559 | 6 | noncoding | -0.489219463 | YLLNEWMNEIK | n[145]YLLNEWMNEIK | MLLLISGPLLGLCNLPISSGFMHCVWSILVLSKYLLNEWMNEIKEQEVRSGI |
lnc-SPATA17-2:1 | BRCA-HER2-enriched | 11 | 0.0246736 | noncoding | 52 | chr1 | 217491974 | 217494283 | + | 0.9959 | lnc-SPATA17-2 | 1 | -5.404 | -5.348 | -3.559 | 6 | noncoding | -0.489219463 | YLLNEWMNEIK | n[145]YLLNEWMNEIK | MLLLISGPLLGLCNLPISSGFMHCVWSILVLSKYLLNEWMNEIKEQEVRSGI |
lnc-SPATA17-2:1 | BRCA-Basal-like | 11 | 0.0246736 | noncoding | 52 | chr1 | 217491974 | 217494283 | + | 0.9959 | lnc-SPATA17-2 | 1 | -5.404 | -5.348 | -3.559 | 6 | noncoding | -0.489219463 | YLLNEWMNEIK | n[145]YLLNEWMNEIK | MLLLISGPLLGLCNLPISSGFMHCVWSILVLSKYLLNEWMNEIKEQEVRSGI |
lnc-SPATA17-2:1 | BRCA-Luminal B | 11 | 0.0246736 | noncoding | 52 | chr1 | 217491974 | 217494283 | + | 0.9959 | lnc-SPATA17-2 | 1 | -5.404 | -5.348 | -3.559 | 6 | noncoding | -0.489219463 | YLLNEWMNEIK | n[145]YLLNEWM[147]NEIK | MLLLISGPLLGLCNLPISSGFMHCVWSILVLSKYLLNEWMNEIKEQEVRSGI |
Page 1 of 1
bottom of page