top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SPG7-3:1 | BRCA-Basal-like | 10 | 0.0124838 | noncoding | 52 | chr16 | 89458869 | 89459437 | + | 0.9987 | lnc-SPG7-3 | 1 | 0 | 0 | 0 | 16 | noncoding | -0.428390039 | TQIHSGELFK | n[145]TQIHSGELFK | LSSGKLLCDERTQIHSGELFKNYTKQGKTVLDEITIHAFIHMGNGSDNGCQC |
lnc-SPG7-3:1 | BRCA-Luminal B | 10 | 0.0124838 | noncoding | 52 | chr16 | 89458869 | 89459437 | + | 0.9987 | lnc-SPG7-3 | 1 | 0 | 0 | 0 | 16 | noncoding | -0.428390039 | TQIHSGELFK | n[145]TQIHSGELFK | LSSGKLLCDERTQIHSGELFKNYTKQGKTVLDEITIHAFIHMGNGSDNGCQC |
lnc-SPG7-3:1 | OV | 10 | 0.0124838 | noncoding | 52 | chr16 | 89458869 | 89459437 | + | 0.995 | lnc-SPG7-3 | 1 | 0 | 0 | 0 | 8 | noncoding | -0.428390039 | TQIHSGELFK | n[145]TQIHSGELFK | LSSGKLLCDERTQIHSGELFKNYTKQGKTVLDEITIHAFIHMGNGSDNGCQC |
lnc-SPHK1-1:1 | EOGC | 14 | 0.0576089 | noncoding | 42 | chr17 | 76345760 | 76346081 | + | 0.5716 | lnc-SPHK1-1 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.353524648 | RSVRLSAKPAPPSK | n[145]RSVRLSAKPAPPSK | MPKRKAEGDAKGDEAKVKDEPQRRSVRLSAKPAPPSKARAQA |
lnc-SPHK1-1:1 | EOGC | 13 | 0.0576089 | noncoding | 42 | chr17 | 76345760 | 76346081 | + | 0.3754 | lnc-SPHK1-1 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.353524648 | SVRLSAKPAPPSK | n[145]SVRLSAKPAPPSK | MPKRKAEGDAKGDEAKVKDEPQRRSVRLSAKPAPPSKARAQA |
Page 1 of 1
bottom of page