top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SPTBN2-2:1 | EOGC | 10 | 0.11006 | noncoding | 96 | chr11 | 66742891 | 66744563 | - | 0.7918 | lnc-SPTBN2-2 | 1 | -2.125 | -3.403 | -2.175 | 7 | noncoding | -0.312564897 | ILPPQLQDAR | n[145]ILPPQLQDAR | LMRDSCLAKSCPRRRVGQGVGCFPSGKILPPQLQDARIGQNRLASWQSACPVHNLGATPKNIVYRDLNHTLLESMLSAPPHSSPSQLLTGRPIGAR |
lnc-SPTBN4-3:1 | OSCC | 15 | 0.00265884 | noncoding | 114 | chr19 | 40443435 | 40444087 | + | 0.8797 | lnc-SPTBN4-3 | 1 | -1.991 | -2.57 | -4.783 | 1 | noncoding | -0.402442789 | TRTLNSSRQPPSPAK | n[145]TRTLNSSRQPPSPAK | LILPPTSPSLLTFKRPWTSPPNSLSGSKTRTLNSSRQPPSPAKHDKAPNSTRPEDPSGIESPGSLSQKFLPSVLSLLQKPNVPASNSLHLKILPQQPRLPSWVLNSVSGPQTLP |
lnc-SPTBN5-2:1 | OV | 9 | 0.0383384 | noncoding | 37 | chr15 | 41769939 | 41773080 | - | 0.5265 | lnc-SPTBN5-2 | 1 | -5.928 | -3.757 | -4.756 | 2 | noncoding | -0.375810234 | LVIEEPSIR | n[145]LVIEEPSIR | MDCLPFLCVQNIFKLVIEEPSIRYFICNSTKKLLYVL |
lnc-SPTBN5-5:1 | EOGC | 8 | 0.131462 | noncoding | 67 | chr15 | 41718369 | 41718672 | - | 0.9974 | lnc-SPTBN5-5 | 1 | 0 | 0 | 0 | 14 | coding | 0.673785743 | AVDSQIVR | n[145]AVDSQIVR | LQKPRHQEGEISDTEKENYKTTEQCKIDQKAVDSQIVRKIKAIPQLQGYLRSVFALTNGIYPHKLVF |
lnc-SPTBN5-5:1 | OSCC | 8 | 0.131462 | noncoding | 67 | chr15 | 41718369 | 41718672 | - | 0.8336 | lnc-SPTBN5-5 | 1 | 0 | 0 | 0 | 1 | coding | 0.673785743 | AVDSQIVR | n[145]AVDSQIVR | LQKPRHQEGEISDTEKENYKTTEQCKIDQKAVDSQIVRKIKAIPQLQGYLRSVFALTNGIYPHKLVF |
Page 1 of 1
bottom of page