top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SRPK1-2:1 | BRCA-Luminal B | 10 | 0.0809341 | noncoding | 71 | chr6 | 35989514 | 35990436 | - | 0.4668 | lnc-SRPK1-2 | 0.477 | 0 | 0 | 0 | 1 | noncoding | -0.418322068 | NPYPNLSLQK | n[145]NPYPNLSLQK | MHSQREHMMFMEKQLEDLNILFNKNPYPNLSLQKEMASKMDMYPTEKKQNKTQESKMQAYSANTISTTAIS |
lnc-SRPK1-2:1 | BRCA-HER2-enriched | 11 | 0.0809341 | noncoding | 71 | chr6 | 35989514 | 35990436 | - | 0.9987 | lnc-SRPK1-2 | 0.477 | 0 | 0 | 0 | 4 | noncoding | -0.418322068 | QLEDLNILFNK | n[145]QLEDLNILFNK | MHSQREHMMFMEKQLEDLNILFNKNPYPNLSLQKEMASKMDMYPTEKKQNKTQESKMQAYSANTISTTAIS |
lnc-SRPK1-2:1 | BRCA-Luminal B | 11 | 0.0809341 | noncoding | 71 | chr6 | 35989514 | 35990436 | - | 0.9987 | lnc-SRPK1-2 | 0.477 | 0 | 0 | 0 | 4 | noncoding | -0.418322068 | QLEDLNILFNK | n[145]QLEDLNILFNK | MHSQREHMMFMEKQLEDLNILFNKNPYPNLSLQKEMASKMDMYPTEKKQNKTQESKMQAYSANTISTTAIS |
lnc-SRPK2-1:9 | CRC | 7 | 0.128649 | noncoding | 41 | chr7 | 104981746 | 104991165 | - | 0.8963 | lnc-SRPK2-1 | 0.08 | 0 | 0 | 0 | 1 | coding | 0.622268144 | VLSGPTK | LGCSDSSTSATQNWDYGCEPPHLASYILIKVLSGPTKVQFA | |
lnc-SRPK2-1:9 | OV | 10 | 0.128649 | noncoding | 33 | chr7 | 104981746 | 104991165 | - | 0.6358 | lnc-SRPK2-1 | 0.102 | -4.498 | -6.131 | -4.307 | 2 | coding | 0.622268144 | LGSFVSVINR | n[145]LGSFVSVINR | LGSFVSVINRTLRIPNQICTFAQKVHLVTLMPP |
Page 1 of 1
bottom of page