top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-ST3GAL1-6:1 | OV | 17 | 0.290657 | noncoding | 51 | chr8 | 133628674 | 133630887 | - | 0.4408 | lnc-ST3GAL1-6 | 0.016 | -5.09 | -4.944 | -4.928 | 2 | noncoding | -0.36236272 | TLWGSLARTLPTSPREL | n[145]TLWGSLARTLPTSPREL | LYLALGLGPVKAEMMKKALLLNGSRAFCRPSHIRTLWGSLARTLPTSPREL |
lnc-ST3GAL4-3:1 | OV | 16 | 0.460393 | noncoding | 71 | chr11 | 126526979 | 126604789 | + | 0.996 | lnc-ST3GAL4-3 | 0.069 | 0 | 0 | 0 | 20 | noncoding | -0.350428756 | LPGNRIRSGEAMCFEK | n[145]LPGNRIRSGEAM[147]CFEK | LPGNRIRSGEAMCFEKVSGLDLQEREVIKGEGQEGEVKVVCVCAHMWVYVCMCIHVCRCVHACVHVYIFPK |
lnc-ST3GAL4-3:1 | OV | 16 | 0.460393 | noncoding | 71 | chr11 | 126526979 | 126604789 | + | 0.996 | lnc-ST3GAL4-3 | 0.069 | 0 | 0 | 0 | 20 | noncoding | -0.350428756 | LPGNRIRSGEAMCFEK | n[145]LPGNRIRSGEAMCFEK | LPGNRIRSGEAMCFEKVSGLDLQEREVIKGEGQEGEVKVVCVCAHMWVYVCMCIHVCRCVHACVHVYIFPK |
lnc-ST3GAL4-5:1 | CCRC | 7 | 0.0846507 | noncoding | 47 | chr11 | 126702545 | 126709151 | + | 0.9978 | lnc-ST3GAL4-5 | 0.062 | -3.932 | -4.695 | -4.248 | 23 | noncoding | -0.363865874 | QAGGLLK | n[230]QAGGLLK | LVTKQAGGLLKEDTGILNRPSPKGSSILLLRPCHGMKASALYVWPPC |
lnc-ST3GAL4-55:17 | HCC | 11 | 0.0460528 | noncoding | 35 | chr11 | 127109453 | 127139719 | + | 0.9967 | lnc-ST3GAL4-55 | 0.843 | -4.749 | -5.024 | -4.182 | 11 | noncoding | -0.392124201 | LIEQQQLPSSR | n[230]LIEQQQLPSSR | LIEQQQLPSSREPGEQTAEKQSSGNMLQEKDITKE |
Page 1 of 1
bottom of page