top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-STK26-6:1 | OV | 10 | 0.10744 | noncoding | 34 | chrX | 132046302 | 132260492 | + | 0.0971 | lnc-STK26-6 | 0.952 | -5.465 | -5.385 | -5.475 | 1 | noncoding | -0.341376538 | RKEHQYLGVK | n[145]RKEHQYLGVK | LVEDGHLQAKKGGLRRKEHQYLGVKLPGSIIVRK |
lnc-STK3-2:7 | BRCA-HER2-enriched | 9 | 0.0844403 | noncoding | 66 | chr8 | 98995931 | 99013029 | - | 0.9993 | lnc-STK3-2 | 0.979 | -4.078 | -3.203 | -4.913 | 1 | noncoding | -0.312003729 | LILIQLCFR | n[145]LILIQLCFR | LLNLLRFGGLSVTAGSIILTNSYNRHKLILIQLCFRNVKIVINQSLLTLFLPFEKEKRKTINYYNQ |
lnc-STK32B-1:1 | OV | 14 | 0.181542 | noncoding | 52 | chr4 | 5033259 | 5033704 | + | 0.3831 | lnc-STK32B-1 | 0.514 | -4.259 | -3.843 | -5.107 | 1 | noncoding | -0.350532383 | EAMVSESGACMWQR | n[145]EAM[147]VSESGACM[147]WQR | MARGNPASPSRFLWTPASGKEAMVSESGACMWQRIRMARRAEAPLSTAAATS |
lnc-STK32B-1:1 | OV | 9 | 0.181542 | noncoding | 52 | chr4 | 5033259 | 5033704 | + | 0.9115 | lnc-STK32B-1 | 0.514 | -4.259 | -3.843 | -5.107 | 7 | noncoding | -0.350532383 | FLWTPASGK | n[145]FLWTPASGK | MARGNPASPSRFLWTPASGKEAMVSESGACMWQRIRMARRAEAPLSTAAATS |
lnc-STK32B-1:1 | OV | 20 | 0.181542 | noncoding | 52 | chr4 | 5033259 | 5033704 | + | 0.0838 | lnc-STK32B-1 | 0.514 | -4.259 | -3.843 | -5.107 | 1 | noncoding | -0.350532383 | MARGNPASPSRFLWTPASGK | n[145]M[147]ARGNPASPSRFLWTPASGK | MARGNPASPSRFLWTPASGKEAMVSESGACMWQRIRMARRAEAPLSTAAATS |
Page 1 of 1
bottom of page