top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-STIM2-12:4 | BRCA-HER2-enriched | 9 | 0.0784902 | noncoding | 58 | chr4 | 28435562 | 28630351 | + | 0.9971 | lnc-STIM2-12 | 0.021 | -5.203 | -5.026 | -4.673 | 25 | noncoding | -0.34220694 | LLTVLQPGK | n[145]LLTVLQPGK | LLTVLQPGKFKTSRSSGESLTPIDDVFVSSHDRRGKQSPLGFFKEDINLIHKGGPLMT |
lnc-STIM2-12:4 | BRCA-Basal-like | 9 | 0.0784902 | noncoding | 58 | chr4 | 28435562 | 28630351 | + | 0.9971 | lnc-STIM2-12 | 0.021 | -5.203 | -5.026 | -4.673 | 25 | noncoding | -0.34220694 | LLTVLQPGK | n[145]LLTVLQPGK | LLTVLQPGKFKTSRSSGESLTPIDDVFVSSHDRRGKQSPLGFFKEDINLIHKGGPLMT |
lnc-STIM2-12:4 | BRCA-Luminal A | 9 | 0.0784902 | noncoding | 58 | chr4 | 28435562 | 28630351 | + | 0.9971 | lnc-STIM2-12 | 0.021 | -5.203 | -5.026 | -4.673 | 25 | noncoding | -0.34220694 | LLTVLQPGK | n[145]LLTVLQPGK | LLTVLQPGKFKTSRSSGESLTPIDDVFVSSHDRRGKQSPLGFFKEDINLIHKGGPLMT |
lnc-STIP1-2:1 | OV | 12 | 0.161618 | noncoding | 35 | chr11 | 64166237 | 64169722 | + | 0.4637 | lnc-STIP1-2 | 0.117 | -4.131 | -2.34 | -5.224 | 1 | noncoding | -0.282002112 | AQLEQNLGQLGR | n[145]AQLEQNLGQLGR | LPSNSPGAKAQLEQNLGQLGRRVEGGNSGIWRQET |
lnc-STIP1-2:1 | OV | 10 | 0.161618 | noncoding | 35 | chr11 | 64166237 | 64169722 | + | 0.4928 | lnc-STIP1-2 | 0.117 | -4.131 | -2.34 | -5.224 | 1 | noncoding | -0.282002112 | VEGGNSGIWR | n[145]VEGGNSGIWR | LPSNSPGAKAQLEQNLGQLGRRVEGGNSGIWRQET |
Page 1 of 1
bottom of page