top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-STX2-8:1 | OV | 7 | 0.0189056 | noncoding | 70 | chr12 | 130874806 | 130877338 | - | 0.368 | lnc-STX2-8 | 1 | 0.427 | 0 | 10.151 | 3 | noncoding | -0.365184462 | AHTVLPK | n[145]AHTVLPK | LTLGSSFILTGHHPHPGEQLSEQPRRRDGKTLTLQIKTARNKQAKPNNLNSKVATIPLSRAHTVLPKLGP |
lnc-STX2-8:1 | OV | 8 | 0.0189056 | noncoding | 70 | chr12 | 130874806 | 130877338 | - | 0.8852 | lnc-STX2-8 | 1 | 0.427 | 0 | 10.151 | 18 | noncoding | -0.365184462 | VATIPLSR | n[145]VATIPLSR | LTLGSSFILTGHHPHPGEQLSEQPRRRDGKTLTLQIKTARNKQAKPNNLNSKVATIPLSRAHTVLPKLGP |
lnc-STX4-1:2 | HCC | 10 | 0.0765744 | noncoding | 33 | chr16 | 31041052 | 31042955 | + | 0.998 | lnc-STX4-1 | 0.075 | 0 | 0 | 0 | 18 | noncoding | -0.325130397 | SPLTANFASR | n[230]SPLTANFASR | LLYRPDWSAVVRSPLTANFASRVHAILLPQAPE |
lnc-STX4-2:1 | PRAD | 25 | 0.0564828 | noncoding | 47 | chr16 | 31028082 | 31028836 | + | 0.8888 | lnc-STX4-2 | 0.058 | 0 | 0 | 0 | 19 | noncoding | -0.384451062 | LPGSGDSPDSASQVAGITGMCHHAR | LPGSGDSPDSASQVAGITGM[147]CHHAR | LLPPAYNGAVLAHCNFRLPGSGDSPDSASQVAGITGMCHHARLILYF |
lnc-STX6-6:3 | BRCA-Luminal B | 10 | 0.0510099 | noncoding | 52 | chr1 | 181093887 | 181105304 | - | 0.9953 | lnc-STX6-6 | 0.998 | -4.241 | -4.558 | -3.052 | 4 | noncoding | -0.326368014 | SLHQVEKSAR | n[145]SLHQVEKSAR | LVKQRNVNKSLHQVEKSARIHWPSRMYTPLPTPCYYDGIGGLVRHSERMISS |
Page 1 of 1
bottom of page