top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-STYXL1-5:1 | EOGC | 11 | 0.0881778 | noncoding | 105 | chr7 | 76117724 | 76132187 | - | 0.9864 | lnc-STYXL1-5 | 1 | 7.397 | 0 | 7.191 | 11 | noncoding | -0.331612942 | EIQEDWELAER | n[145]EIQEDWELAER | LCKEGCGYYGNPAWQGFCSKCWREEYHKARQKEIQEDWELAERLALSPQLEYSGAVSTHCILCFLGSSDPPASASQVARTTPVGGRGLCQQSEQPRGPIPHILQV |
lnc-SUCLA2-12:1 | OV | 10 | 0.0841382 | noncoding | 40 | chr13 | 48041750 | 48042184 | - | 0.9873 | lnc-SUCLA2-12 | 0.771 | -5.918 | -4.949 | -5.232 | 13 | noncoding | -0.436006226 | DGINSPAQVR | n[145]DGINSPAQVR | MDGINSPAQVRKLSKTDKIFSLKLLPETKLNNNNKTYCVH |
lnc-SUCLA2-9:1 | EOGC | 9 | 0.0155128 | noncoding | 33 | chr13 | 47474975 | 47476090 | - | 0.9998 | lnc-SUCLA2-9 | 1 | -3.704 | -4.549 | -4.104 | 32 | noncoding | -0.425690708 | EGITPHLAR | n[145]EGITPHLAR | LLLSILMREGITPHLARQCTVNSQAVFLRVQVT |
lnc-SUCLA2-9:1 | OV | 9 | 0.0155128 | noncoding | 33 | chr13 | 47474975 | 47476090 | - | 0.9983 | lnc-SUCLA2-9 | 1 | -3.704 | -4.549 | -4.104 | 12 | noncoding | -0.425690708 | EGITPHLAR | n[145]EGITPHLAR | LLLSILMREGITPHLARQCTVNSQAVFLRVQVT |
lnc-SUCLG1-4:1 | CCRC | 8 | 0.108087 | noncoding | 71 | chr2 | 84039884 | 84040720 | - | 0.9944 | lnc-SUCLG1-4 | 0.411 | 0 | 0 | 0 | 1 | noncoding | -0.329666483 | SHIPTAFR | n[230]SHIPTAFR | LPERLLTQELWDRLKQLGAPHAASSPTLPSHGHNPEQSEWLLRMLSCTPPPRSHIPTAFRAPRWLTEVEVS |
Page 1 of 1
bottom of page