top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SUN2-1:1 | HCC | 13 | 0.0384913 | noncoding | 54 | chr22 | 38722742 | 38723505 | - | 0.7949 | lnc-SUN2-1 | 1 | -3.558 | -5.213 | -4.066 | 2 | noncoding | -0.339262837 | LTNILWSGSSQAK | n[230]LTNILWSGSSQAK | LTNILWSGSSQAKFFSTSSSYHAPAVAQHAPYFKGTAIVNGEFKDLSLDDFKGK |
lnc-SUN2-1:1 | OV | 10 | 0.0384913 | noncoding | 54 | chr22 | 38722742 | 38723505 | - | 0.9289 | lnc-SUN2-1 | 1 | -3.558 | -5.213 | -4.066 | 8 | noncoding | -0.339262837 | GTAIVNGEFK | n[145]GTAIVNGEFK | LTNILWSGSSQAKFFSTSSSYHAPAVAQHAPYFKGTAIVNGEFKDLSLDDFKGK |
lnc-SUN2-1:1 | OV | 18 | 0.0384913 | noncoding | 54 | chr22 | 38722742 | 38723505 | - | 1 | lnc-SUN2-1 | 1 | -3.558 | -5.213 | -4.066 | 5 | noncoding | -0.339262837 | GTAIVNGEFKDLSLDDFK | n[145]GTAIVNGEFKDLSLDDFK | LTNILWSGSSQAKFFSTSSSYHAPAVAQHAPYFKGTAIVNGEFKDLSLDDFKGK |
lnc-SUPT16H-3:2 | OV | 9 | 0.0132107 | noncoding | 49 | chr14 | 21262992 | 21269389 | - | 0.9953 | lnc-SUPT16H-3 | 1 | -1.737 | -2.82 | -3.396 | 4 | noncoding | -0.38479427 | ESEGISIFK | n[145]ESEGISIFK | LNVSKNFSGLLIDFGVLHLGRESEGISIFKWFDHVNLFSPNPTLALIPF |
lnc-SUPT3H-2:1 | OV | 11 | 0.00854292 | noncoding | 54 | chr6 | 45421078 | 45422005 | - | 0.7976 | lnc-SUPT3H-2 | 1 | -1.277 | 6.568 | 5.615 | 20 | noncoding | -0.28862083 | IAAAAAASRPR | n[145]IAAAAAASRPR | LQSSPVSRASRCQEVSRGQRISGQRISSLRIAAAAAASRPREGAPRAPCAVSEA |
Page 1 of 1
bottom of page