top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SYT13-8:1 | OV | 16 | 0.0840833 | noncoding | 39 | chr11 | 44929351 | 44930992 | - | 0.9519 | lnc-SYT13-8 | 1 | -3.76 | -5.104 | -4.143 | 7 | noncoding | -0.331553587 | LSVPGGMQEGGEVLAR | n[145]LSVPGGM[147]QEGGEVLAR | LGGSKLSVPGGMQEGGEVLARMLKKISKPQFWVWRGRPR |
lnc-SYT13-8:1 | OV | 16 | 0.0840833 | noncoding | 39 | chr11 | 44929351 | 44930992 | - | 0.9519 | lnc-SYT13-8 | 1 | -3.76 | -5.104 | -4.143 | 7 | noncoding | -0.331553587 | LSVPGGMQEGGEVLAR | n[145]LSVPGGMQEGGEVLAR | LGGSKLSVPGGMQEGGEVLARMLKKISKPQFWVWRGRPR |
lnc-SYT16-67:16 | BRCA-HER2-enriched | 11 | 0.0545272 | noncoding | 54 | chr14 | 62127243 | 62128537 | + | 0.9972 | lnc-SYT16-67 | 0.408 | -4.915 | -4.36 | -5.129 | 1 | coding | 0.590155043 | FGCVLTLNGMK | n[145]FGCVLTLNGMK | LGCQLFYASLINLVTLNDLSVLGSLTKRMMKNFFSPPITFHFKFGCVLTLNGMK |
lnc-SYT8-3:1 | BRCA-Luminal B | 13 | 0.161012 | noncoding | 106 | chr11 | 1792552 | 1792870 | + | 0.9519 | lnc-SYT8-3 | 1 | 0 | 0 | 0 | 2 | noncoding | -0.324263426 | IVLGLECIQPNCR | n[145]IVLGLECIQPNCR | MVKVPKTRRTFCKKCDKHQPHKVRQYKDGKDSLYAQGKWRYDRKQSGYGGQTKPIFRKKAKTTKKIVLGLECIQPNCRSKRMLATERCKHFELGGDKKRKGQMIQF |
lnc-SYT8-3:1 | BRCA-Luminal A | 13 | 0.161012 | noncoding | 106 | chr11 | 1792552 | 1792870 | + | 0.9519 | lnc-SYT8-3 | 1 | 0 | 0 | 0 | 2 | noncoding | -0.324263426 | IVLGLECIQPNCR | n[145]IVLGLECIQPNCR | MVKVPKTRRTFCKKCDKHQPHKVRQYKDGKDSLYAQGKWRYDRKQSGYGGQTKPIFRKKAKTTKKIVLGLECIQPNCRSKRMLATERCKHFELGGDKKRKGQMIQF |
Page 1 of 1
bottom of page