top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-SYT13-2:1 | BRCA-Luminal A | 12 | 0.129035 | noncoding | 54 | chr11 | 45146642 | 45214738 | - | 0.5609 | lnc-SYT13-2 | 1 | 0.996 | 10.467 | 6.678 | 1 | noncoding | -0.305783705 | VGADAGEAGPRR | n[145]VGADAGEAGPRR | LCFLFRDLVVRVGADAGEAGPRRGKVSAPASARRRRRLAAALLPCFDHHLISTG |
lnc-SYT13-2:1 | BRCA-HER2-enriched | 14 | 0.129035 | noncoding | 54 | chr11 | 45146642 | 45214738 | - | 0.5225 | lnc-SYT13-2 | 1 | 0.996 | 10.467 | 6.678 | 5 | noncoding | -0.305783705 | VGADAGEAGPRRGK | n[145]VGADAGEAGPRRGK | LCFLFRDLVVRVGADAGEAGPRRGKVSAPASARRRRRLAAALLPCFDHHLISTG |
lnc-SYT13-2:1 | BRCA-Luminal A | 14 | 0.129035 | noncoding | 54 | chr11 | 45146642 | 45214738 | - | 0.5225 | lnc-SYT13-2 | 1 | 0.996 | 10.467 | 6.678 | 5 | noncoding | -0.305783705 | VGADAGEAGPRRGK | n[145]VGADAGEAGPRRGK | LCFLFRDLVVRVGADAGEAGPRRGKVSAPASARRRRRLAAALLPCFDHHLISTG |
lnc-SYT13-2:1 | BRCA-Basal-like | 14 | 0.129035 | noncoding | 54 | chr11 | 45146642 | 45214738 | - | 0.5225 | lnc-SYT13-2 | 1 | 0.996 | 10.467 | 6.678 | 5 | noncoding | -0.305783705 | VGADAGEAGPRRGK | n[145]VGADAGEAGPRRGK | LCFLFRDLVVRVGADAGEAGPRRGKVSAPASARRRRRLAAALLPCFDHHLISTG |
lnc-SYT13-2:1 | HCC | 17 | 0.129035 | noncoding | 64 | chr11 | 45146642 | 45214738 | - | 0.9611 | lnc-SYT13-2 | 1 | -3.749 | -3.084 | -3.575 | 2 | noncoding | -0.305783705 | QSFPSSDVIPFFSPLQK | QSFPSSDVIPFFSPLQK | LRPPRLCKGEEKHKVLSMNARQSFPSSDVIPFFSPLQKRQAQQLSTRTRASGGPRRAPPPGKGG |
Page 1 of 1
bottom of page