top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TBC1D22A-4:13 | LUAD | 12 | 0.216963 | noncoding | 80 | chr22 | 47631702 | 47907917 | + | 0.1098 | lnc-TBC1D22A-4 | 0.209 | -4.709 | -2.8 | -3.144 | 2 | noncoding | -0.278173546 | VTCLVSDDADLR | n[230]VTCLVSDDADLR | LTLKWFWHLQCLMRKLSPREVEQVVRGHVRLPQQMQDVRRVHGGYRTLLFHTGKPPFKVTCLVSDDADLRFLVTVQPDVC |
lnc-TBC1D22A-4:13 | OV | 9 | 0.216963 | noncoding | 60 | chr22 | 47631702 | 47907917 | + | 0.9857 | lnc-TBC1D22A-4 | 0.075 | 0 | 0 | 0 | 9 | noncoding | -0.278173546 | LLLQIVESK | n[145]LLLQIVESK | LLLQIVESKGQRTWSSNAQGQESQCAPSPGEREQVSKLFLPLPFCPVQALSQFNRACHTG |
lnc-TBC1D22A-4:13 | OV | 19 | 0.216963 | noncoding | 50 | chr22 | 47631702 | 47907917 | + | 0.6712 | lnc-TBC1D22A-4 | 0.004 | -5.619 | -4.063 | -3.903 | 5 | noncoding | -0.278173546 | LLNGVLSLVSAFSISESVF | n[145]LLNGVLSLVSAFSISESVF | LCAWAAEPALHLFSIWCGFPACMKHNVVTFRLLNGVLSLVSAFSISESVF |
lnc-TBC1D22A-4:13 | OV | 9 | 0.216963 | noncoding | 33 | chr22 | 47631702 | 47907917 | + | 0.8129 | lnc-TBC1D22A-4 | 0.132 | -5.349 | -3.898 | -3.419 | 7 | noncoding | -0.278173546 | LTAALTTPR | n[145]LTAALTTPR | LTAALTTPRLLSICLHMPGPCPPSAPVTSRSLS |
lnc-TBC1D22A-4:13 | OV | 24 | 0.216963 | noncoding | 58 | chr22 | 47631702 | 47907917 | + | 0.768 | lnc-TBC1D22A-4 | 0.016 | -4.528 | -4.427 | -4.302 | 5 | noncoding | -0.278173546 | WPWHVESAFAPFQHHLMTCSVLMK | n[145]WPWHVESAFAPFQHHLM[147]TCSVLMK | LMVSESSRGREALWGQDVAEEENSQRWPWHVESAFAPFQHHLMTCSVLMKMLYVFSVH |
Page 1 of 1
bottom of page